VENTXP1 (VENT homeobox pseudogene 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 139538 |
| Gene name | VENT homeobox pseudogene 1 |
| Gene symbol | VENTXP1 |
| Synonyms (NCBI Gene) |
CT18NA88AVENTX2P1
|
| Chromosome | X |
| Chromosome location | Xp21.3 |
| Summary | Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This pseudogene is a member of the Vent |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0C5K6 |
| Protein name | Putative tumor antigen NA88-A (Cancer/testis antigen 18) (CT18) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in testis and melanoma cell lines. {ECO:0000269|PubMed:10790436}. |
| Sequence |
MSPPSSMCSPVPLLAAASGQNRMTQGQHFLQKV |
| Sequence length | 33 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with VENTXP1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to VENTXP1 (see Related Genes above), that are NOT already directly curated for VENTXP1 itself -- a lead worth checking, not a confirmed association.
0
|
|