VEGFA (vascular endothelial growth factor A)

Gene

• Entrez ID: 7422
• Gene name: Vascular endothelial growth factor A
• Gene symbol: VEGFA
• Synonyms (NCBI Gene): L-VEGF, MVCD1, VEGF, VPF
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for bot

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2010963	C>G,T	Risk-factor	Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs756155710	GACA>-,GACAGACA,GACAGACAGACA	Likely-pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant, upstream transcript variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000722	hsa-miR-302d-3p	Review	19574400
MIRT000721	hsa-miR-373-3p	Review	19574400
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	19223090
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	19223090
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	19238171
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003428	hsa-miR-126-3p	Review	20130964
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT003890	hsa-miR-16-5p	ELISA, Luciferase reporter assay	18320040
MIRT004450	hsa-miR-20a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004450	hsa-miR-20a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004451	hsa-miR-20b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004513	hsa-miR-34a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004519	hsa-miR-34b-3p	ELISA, Luciferase reporter assay	18320040
MIRT004055	hsa-miR-93-5p	ELISA, Luciferase reporter assay	18320040
MIRT004465	hsa-miR-106a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004466	hsa-miR-106b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004272	hsa-miR-150-5p	ELISA, Luciferase reporter assay	18320040
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	18320040
MIRT004278	hsa-miR-330-3p	ELISA, Luciferase reporter assay	18320040
MIRT004277	hsa-miR-378a-3p	ELISA, Luciferase reporter assay	18320040
MIRT004276	hsa-miR-520g-3p	ELISA, Luciferase reporter assay	18320040
MIRT004275	hsa-miR-15a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004274	hsa-miR-15b-5p	ELISA, Luciferase reporter assay	18320040
MIRT003813	hsa-miR-29b-3p	ELISA, Luciferase reporter assay	18320040
MIRT003814	hsa-miR-107	ELISA, Luciferase reporter assay	18320040
MIRT003811	hsa-miR-134-5p	ELISA, Luciferase reporter assay	18320040
MIRT003812	hsa-miR-140-5p	ELISA, Luciferase reporter assay	18320040
MIRT003810	hsa-miR-147a	ELISA, Luciferase reporter assay	18320040
MIRT004518	hsa-miR-205-5p	ELISA, Luciferase reporter assay	18320040
MIRT000722	hsa-miR-302d-3p	ELISA, Luciferase reporter assay	18320040
MIRT004447	hsa-miR-361-5p	ELISA, Luciferase reporter assay	18320040
MIRT000721	hsa-miR-373-3p	ELISA, Luciferase reporter assay	18320040
MIRT004443	hsa-miR-383-5p	ELISA, Luciferase reporter assay	18320040
MIRT004457	hsa-miR-504-5p	ELISA, Luciferase reporter assay	18320040
MIRT004458	hsa-miR-520h	ELISA, Luciferase reporter assay	18320040
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	15131085
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, Western blot	21249429
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, Western blot	21249429
MIRT006771	hsa-miR-200c-3p	Luciferase reporter assay	22685266
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	21885851
MIRT006771	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23083510
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT007224	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT007224	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay	23233752
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT016911	hsa-miR-335-5p	Microarray	18185580
MIRT020389	hsa-miR-29c-3p	Sequencing	20371350
MIRT004466	hsa-miR-106b-5p	Microarray	17242205
MIRT004466	hsa-miR-106b-5p	Microarray	17242205
MIRT021081	hsa-miR-190a-5p	Other	21750348
MIRT003428	hsa-miR-126-3p	Reporter assay;Western blot	21249429
MIRT003428	hsa-miR-126-3p	Reporter assay	19223090
MIRT021401	hsa-miR-9-5p	qRT-PCR;Other	20173740
MIRT021711	hsa-miR-133a-3p	Reporter assay	21249429
MIRT004518	hsa-miR-205-5p	Reporter assay	19238171
MIRT027248	hsa-miR-101-3p	Sequencing	20371350
MIRT030717	hsa-miR-21-5p	qRT-PCR	19435867
MIRT030717	hsa-miR-21-5p	Western blot;qRT-PCR	21544242
MIRT003890	hsa-miR-16-5p	Reporter assay	15131085
MIRT004518	hsa-miR-205-5p	U87	22159356
MIRT004518	hsa-miR-205-5p	U87	22159356
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22159356
MIRT006215	hsa-miR-145-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR	22592534
MIRT053074	hsa-miR-203a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23867971
MIRT004447	hsa-miR-361-5p	qRT-PCR, Western blot	23128854
MIRT004465	hsa-miR-106a-5p	Microarray	23807165
MIRT004277	hsa-miR-378a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23333942
MIRT053585	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24209632
MIRT053585	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24209632
MIRT004447	hsa-miR-361-5p	ELISA, Luciferase reporter assay, qRT-PCR	23166713
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	25428912
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	25428912
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blotting	24886719
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23900443
MIRT360955	hsa-miR-185-5p	MDA-MB-231	25448984
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay	23468064
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay	23468064
MIRT027248	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR	23608225
MIRT027248	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR	23608225
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	24140635
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	25172656
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	24140635
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	25172656
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT552967	hsa-miR-8485	HITS-CLIP	21572407
MIRT552966	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT552965	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT552964	hsa-miR-603	HITS-CLIP	21572407
MIRT552963	hsa-miR-4719	HITS-CLIP	21572407
MIRT552962	hsa-miR-3941	HITS-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT169147	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT707039	hsa-miR-4497	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT651756	hsa-miR-5694	HITS-CLIP	23824327
MIRT651755	hsa-miR-5193	HITS-CLIP	23824327
MIRT651754	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT651753	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT651752	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT464233	hsa-miR-5692a	PAR-CLIP	20371350
MIRT317923	hsa-miR-3646	PAR-CLIP	20371350
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT464232	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT464231	hsa-miR-5688	PAR-CLIP	20371350
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	20371350
MIRT317921	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT317924	hsa-miR-5682	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT552970	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT003428	hsa-miR-126-3p	PAR-CLIP	21572407
MIRT552969	hsa-miR-4263	PAR-CLIP	21572407
MIRT552968	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT552967	hsa-miR-8485	PAR-CLIP	21572407
MIRT552966	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT552965	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT552964	hsa-miR-603	PAR-CLIP	21572407
MIRT552963	hsa-miR-4719	PAR-CLIP	21572407
MIRT552962	hsa-miR-3941	PAR-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT100742	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT004273	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT003890	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT100741	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT007224	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT464235	hsa-miR-3662	PAR-CLIP	21572407
MIRT100747	hsa-miR-451b	PAR-CLIP	21572407
MIRT464234	hsa-miR-646	PAR-CLIP	21572407
MIRT100745	hsa-miR-3163	PAR-CLIP	21572407
MIRT100743	hsa-miR-598-5p	PAR-CLIP	21572407
MIRT122988	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT100742	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT004273	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT003890	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT100741	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT007224	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT464235	hsa-miR-3662	PAR-CLIP	22012620
MIRT100747	hsa-miR-451b	PAR-CLIP	22012620
MIRT464234	hsa-miR-646	PAR-CLIP	22012620
MIRT100745	hsa-miR-3163	PAR-CLIP	22012620
MIRT100743	hsa-miR-598-5p	PAR-CLIP	22012620
MIRT122988	hsa-miR-423-3p	PAR-CLIP	22012620
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	22012620
MIRT169150	hsa-miR-299-3p	PAR-CLIP	23446348
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT520234	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT520233	hsa-miR-5692b	PAR-CLIP	23446348
MIRT520232	hsa-miR-5692c	PAR-CLIP	23446348
MIRT520231	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT520230	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT520229	hsa-miR-6745	PAR-CLIP	23446348
MIRT169216	hsa-miR-6756-5p	PAR-CLIP	23446348
MIRT169218	hsa-miR-6766-5p	PAR-CLIP	23446348
MIRT520228	hsa-miR-1293	PAR-CLIP	23446348
MIRT520227	hsa-miR-4483	PAR-CLIP	23446348
MIRT169219	hsa-miR-6769a-5p	PAR-CLIP	23446348
MIRT169225	hsa-miR-6769b-5p	PAR-CLIP	23446348
MIRT520226	hsa-miR-567	PAR-CLIP	23446348
MIRT169215	hsa-miR-6748-5p	PAR-CLIP	23446348
MIRT520225	hsa-miR-6793-5p	PAR-CLIP	23446348
MIRT520224	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT520223	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT169196	hsa-miR-3924	PAR-CLIP	23446348
MIRT169172	hsa-miR-297	PAR-CLIP	23446348
MIRT169217	hsa-miR-6759-5p	PAR-CLIP	23446348
MIRT100755	hsa-miR-568	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT100742	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT004273	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT003890	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT100741	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT007224	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT464235	hsa-miR-3662	PAR-CLIP	24398324
MIRT100747	hsa-miR-451b	PAR-CLIP	24398324
MIRT464234	hsa-miR-646	PAR-CLIP	24398324
MIRT100745	hsa-miR-3163	PAR-CLIP	24398324
MIRT100743	hsa-miR-598-5p	PAR-CLIP	24398324
MIRT122988	hsa-miR-423-3p	PAR-CLIP	24398324
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT464233	hsa-miR-5692a	PAR-CLIP	23592263
MIRT317923	hsa-miR-3646	PAR-CLIP	23592263
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT464232	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT464231	hsa-miR-5688	PAR-CLIP	23592263
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT317921	hsa-miR-95-5p	PAR-CLIP	23592263
MIRT317924	hsa-miR-5682	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT003890	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT004273	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	26396534
MIRT004275	hsa-miR-15a-5p	Chromatin immunoprecipitation, Immunoblot, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR	27322147
MIRT731842	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27777493
MIRT731842	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27777493
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26398444
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26398444
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay	28122882
MIRT732343	hsa-miR-125a-3p	SGC7901	26398444
MIRT732343	hsa-miR-125a-3p	SGC7901	26398444
MIRT006440	hsa-miR-200b-3p	qRT-PCR, Western blot	25884496
MIRT053585	hsa-miR-29a-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT053585	hsa-miR-29a-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT020389	hsa-miR-29c-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT020389	hsa-miR-29c-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT003813	hsa-miR-29b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28222438
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26402430
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26402430
MIRT004447	hsa-miR-361-5p	Luciferase reporter assay, Western blot	27641667
MIRT004451	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26612965
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26783726
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT731842	hsa-miR-1-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28493075
MIRT731842	hsa-miR-1-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28493075
MIRT731842	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT731842	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT755306	hsa-miR-206	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT755306	hsa-miR-206	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT004275	hsa-miR-15a-5p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27916780
MIRT004275	hsa-miR-15a-5p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27916780
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay	25658842
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay	25658842
MIRT004055	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	26175939
MIRT004055	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	26175939
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT732741	hsa-miR-452-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31652600
MIRT004518	hsa-miR-205-5p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	32065361
MIRT003428	hsa-miR-126-3p	Immunohistochemistry (IHC), In situ hybridization, Microarray	34055877
MIRT733237	hsa-miR-20b-3p	Immunohistochemistry (IHC), In situ hybridization, Microarray	34055877
MIRT733238	hsa-miR-106a-3p	Immunohistochemistry (IHC), In situ hybridization, Microarray	34055877
MIRT100747	hsa-miR-451b	Luciferase reporter assay, qRT-PCR, Western blotting	31922013
MIRT360955	hsa-miR-185-5p	Immunocytochemistry (ICC), Microarray, qRT-PCR	33916610
MIRT464234	hsa-miR-646	Luciferase reporter assay, qRT-PCR, Western blotting	32782496
MIRT003428	hsa-miR-126-3p	Immunofluorescence, Immunohistochemistry (IHC), qRT-PCR, Western blotting	32705156
MIRT734928	hsa-miR-214-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	33280526
MIRT735115	hsa-miR-885-3p	qRT-PCR	31776299
MIRT004271	hsa-miR-17-5p	qRT-PCR	31776299
MIRT520223	hsa-miR-374b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunocytochemistry (ICC)	32617008
MIRT003428	hsa-miR-126-3p	qRT-PCR	32425976
MIRT735343	hsa-miR-590-3p	Luciferase reporter assay, qRT-PCR, ELISA	32277427
MIRT004451	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	33469291
MIRT735579	hsa-miR-4316	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32123520
MIRT735804	hsa-miR-199b-5p	Western blotting, qRT-PCR	32178301
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	31737629
MIRT737019	hsa-miR-377-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33906524
MIRT737165	hsa-miR-29b-2-5p	Western blotting, Microarray, qRT-PCR	33262463
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT552967	hsa-miR-8485	HITS-CLIP	21572407
MIRT552966	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT552965	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT552964	hsa-miR-603	HITS-CLIP	21572407
MIRT552963	hsa-miR-4719	HITS-CLIP	21572407
MIRT552962	hsa-miR-3941	HITS-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT169147	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT707039	hsa-miR-4497	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT651756	hsa-miR-5694	HITS-CLIP	23824327
MIRT651755	hsa-miR-5193	HITS-CLIP	23824327
MIRT651754	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT651753	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT651752	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT464233	hsa-miR-5692a	PAR-CLIP	20371350
MIRT317923	hsa-miR-3646	PAR-CLIP	20371350
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT464232	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT464231	hsa-miR-5688	PAR-CLIP	20371350
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	20371350
MIRT317921	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT317924	hsa-miR-5682	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT552970	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT003428	hsa-miR-126-3p	PAR-CLIP	21572407
MIRT552969	hsa-miR-4263	PAR-CLIP	21572407
MIRT552968	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT552967	hsa-miR-8485	PAR-CLIP	21572407
MIRT552966	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT552965	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT552964	hsa-miR-603	PAR-CLIP	21572407
MIRT552963	hsa-miR-4719	PAR-CLIP	21572407
MIRT552962	hsa-miR-3941	PAR-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT100742	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT004273	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT003890	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT100741	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT007224	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT464235	hsa-miR-3662	PAR-CLIP	21572407
MIRT100747	hsa-miR-451b	PAR-CLIP	21572407
MIRT464234	hsa-miR-646	PAR-CLIP	21572407
MIRT100745	hsa-miR-3163	PAR-CLIP	21572407
MIRT100743	hsa-miR-598-5p	PAR-CLIP	21572407
MIRT122988	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT100742	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT004273	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT003890	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT100741	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT007224	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT464235	hsa-miR-3662	PAR-CLIP	22012620
MIRT100747	hsa-miR-451b	PAR-CLIP	22012620
MIRT464234	hsa-miR-646	PAR-CLIP	22012620
MIRT100745	hsa-miR-3163	PAR-CLIP	22012620
MIRT100743	hsa-miR-598-5p	PAR-CLIP	22012620
MIRT122988	hsa-miR-423-3p	PAR-CLIP	22012620
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	22012620
MIRT169150	hsa-miR-299-3p	PAR-CLIP	23446348
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT520234	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT520233	hsa-miR-5692b	PAR-CLIP	23446348
MIRT520232	hsa-miR-5692c	PAR-CLIP	23446348
MIRT520231	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT520230	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT520229	hsa-miR-6745	PAR-CLIP	23446348
MIRT169216	hsa-miR-6756-5p	PAR-CLIP	23446348
MIRT169218	hsa-miR-6766-5p	PAR-CLIP	23446348
MIRT520228	hsa-miR-1293	PAR-CLIP	23446348
MIRT520227	hsa-miR-4483	PAR-CLIP	23446348
MIRT169219	hsa-miR-6769a-5p	PAR-CLIP	23446348
MIRT169225	hsa-miR-6769b-5p	PAR-CLIP	23446348
MIRT520226	hsa-miR-567	PAR-CLIP	23446348
MIRT169215	hsa-miR-6748-5p	PAR-CLIP	23446348
MIRT520225	hsa-miR-6793-5p	PAR-CLIP	23446348
MIRT520224	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT520223	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT169196	hsa-miR-3924	PAR-CLIP	23446348
MIRT169172	hsa-miR-297	PAR-CLIP	23446348
MIRT169217	hsa-miR-6759-5p	PAR-CLIP	23446348
MIRT100755	hsa-miR-568	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT100742	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT004273	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT003890	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT100741	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT007224	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT464235	hsa-miR-3662	PAR-CLIP	24398324
MIRT100747	hsa-miR-451b	PAR-CLIP	24398324
MIRT464234	hsa-miR-646	PAR-CLIP	24398324
MIRT100745	hsa-miR-3163	PAR-CLIP	24398324
MIRT100743	hsa-miR-598-5p	PAR-CLIP	24398324
MIRT122988	hsa-miR-423-3p	PAR-CLIP	24398324
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT464233	hsa-miR-5692a	PAR-CLIP	23592263
MIRT317923	hsa-miR-3646	PAR-CLIP	23592263
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT464232	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT464231	hsa-miR-5688	PAR-CLIP	23592263
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT317921	hsa-miR-95-5p	PAR-CLIP	23592263
MIRT317924	hsa-miR-5682	PAR-CLIP	23592263
MIRT755306	hsa-miR-206	Luciferase reporter assay, Western blotting, qRT-PCR	34697590
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34712495
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35722425
MIRT003428	hsa-miR-126-3p	Microarray, qRT-PCR	35816043
MIRT004275	hsa-miR-15a-5p	Microarray, qRT-PCR	35816043
MIRT004518	hsa-miR-205-5p	Microarray, qRT-PCR	35816043
MIRT004443	hsa-miR-383-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37592783
MIRT756092	hsa-miR-23a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34765018
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37026504
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT1483797	hsa-miR-24	CLIP-seq
MIRT1483798	hsa-miR-2467-5p	CLIP-seq
MIRT1483799	hsa-miR-3132	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT1483801	hsa-miR-3661	CLIP-seq
MIRT1483802	hsa-miR-4256	CLIP-seq
MIRT1483803	hsa-miR-4279	CLIP-seq
MIRT1483804	hsa-miR-4446-3p	CLIP-seq
MIRT1483805	hsa-miR-4451	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT1483807	hsa-miR-4492	CLIP-seq
MIRT1483808	hsa-miR-4498	CLIP-seq
MIRT1483809	hsa-miR-4505	CLIP-seq
MIRT1483810	hsa-miR-4652-3p	CLIP-seq
MIRT1483811	hsa-miR-4685-5p	CLIP-seq
MIRT1483812	hsa-miR-629	CLIP-seq
MIRT1483813	hsa-miR-631	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483815	hsa-miR-762	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT1483817	hsa-miR-106a	CLIP-seq
MIRT1483818	hsa-miR-106b	CLIP-seq
MIRT1483819	hsa-miR-1249	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483820	hsa-miR-1470	CLIP-seq
MIRT1483821	hsa-miR-15a	CLIP-seq
MIRT1483822	hsa-miR-15b	CLIP-seq
MIRT1483823	hsa-miR-16	CLIP-seq
MIRT1483824	hsa-miR-17	CLIP-seq
MIRT1483825	hsa-miR-1825	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483827	hsa-miR-195	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT1483828	hsa-miR-20a	CLIP-seq
MIRT1483829	hsa-miR-20b	CLIP-seq
MIRT1483830	hsa-miR-2115	CLIP-seq
MIRT1483831	hsa-miR-302a	CLIP-seq
MIRT1483832	hsa-miR-302b	CLIP-seq
MIRT1483833	hsa-miR-302c	CLIP-seq
MIRT1483834	hsa-miR-302d	CLIP-seq
MIRT1483835	hsa-miR-302e	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483837	hsa-miR-3152-3p	CLIP-seq
MIRT1483838	hsa-miR-3160-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT1483840	hsa-miR-3194-3p	CLIP-seq
MIRT1483841	hsa-miR-3202	CLIP-seq
MIRT1483842	hsa-miR-3616-3p	CLIP-seq
MIRT1483843	hsa-miR-3659	CLIP-seq
MIRT1483844	hsa-miR-3671	CLIP-seq
MIRT1483845	hsa-miR-3687	CLIP-seq
MIRT1483846	hsa-miR-372	CLIP-seq
MIRT1483847	hsa-miR-373	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT1483849	hsa-miR-3908	CLIP-seq
MIRT1483850	hsa-miR-3942-5p	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483852	hsa-miR-424	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483855	hsa-miR-4274	CLIP-seq
MIRT1483856	hsa-miR-4290	CLIP-seq
MIRT1483857	hsa-miR-4294	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483859	hsa-miR-4436b-3p	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483861	hsa-miR-4442	CLIP-seq
MIRT1483862	hsa-miR-4524	CLIP-seq
MIRT1483863	hsa-miR-4533	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT1483865	hsa-miR-4658	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT1483868	hsa-miR-4703-5p	CLIP-seq
MIRT1483869	hsa-miR-4728-5p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT1483871	hsa-miR-4747-5p	CLIP-seq
MIRT1483872	hsa-miR-4766-3p	CLIP-seq
MIRT1483873	hsa-miR-4796-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483875	hsa-miR-497	CLIP-seq
MIRT1483876	hsa-miR-503	CLIP-seq
MIRT1483877	hsa-miR-516a-3p	CLIP-seq
MIRT1483878	hsa-miR-519d	CLIP-seq
MIRT1483879	hsa-miR-520a-3p	CLIP-seq
MIRT1483880	hsa-miR-520b	CLIP-seq
MIRT1483881	hsa-miR-520c-3p	CLIP-seq
MIRT1483882	hsa-miR-520d-3p	CLIP-seq
MIRT1483883	hsa-miR-520e	CLIP-seq
MIRT1483884	hsa-miR-520g	CLIP-seq
MIRT1483885	hsa-miR-542-5p	CLIP-seq
MIRT1483886	hsa-miR-548a-3p	CLIP-seq
MIRT1483887	hsa-miR-548e	CLIP-seq
MIRT1483888	hsa-miR-548f	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT1483890	hsa-miR-574-5p	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483892	hsa-miR-638	CLIP-seq
MIRT1483893	hsa-miR-711	CLIP-seq
MIRT1483894	hsa-miR-93	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT2145610	hsa-miR-1236	CLIP-seq
MIRT2145611	hsa-miR-1285	CLIP-seq
MIRT2145612	hsa-miR-134	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT2145613	hsa-miR-139-5p	CLIP-seq
MIRT2145614	hsa-miR-146b-3p	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT2145616	hsa-miR-3118	CLIP-seq
MIRT2145617	hsa-miR-3173-5p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT2145618	hsa-miR-3187-5p	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2145619	hsa-miR-3618	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483844	hsa-miR-3671	CLIP-seq
MIRT2145621	hsa-miR-3686	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT2145623	hsa-miR-3974	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483855	hsa-miR-4274	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT2145624	hsa-miR-4455	CLIP-seq
MIRT2145625	hsa-miR-4467	CLIP-seq
MIRT2145626	hsa-miR-4476	CLIP-seq
MIRT2145627	hsa-miR-4491	CLIP-seq
MIRT2145628	hsa-miR-4534	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT1483810	hsa-miR-4652-3p	CLIP-seq
MIRT2145629	hsa-miR-4657	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT2145631	hsa-miR-4700-3p	CLIP-seq
MIRT2145632	hsa-miR-4711-3p	CLIP-seq
MIRT2145633	hsa-miR-4742-3p	CLIP-seq
MIRT2145634	hsa-miR-4751	CLIP-seq
MIRT2145635	hsa-miR-4753-3p	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT2145638	hsa-miR-4802-5p	CLIP-seq
MIRT2145639	hsa-miR-493	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT2145644	hsa-miR-609	CLIP-seq
MIRT2145645	hsa-miR-612	CLIP-seq
MIRT2145646	hsa-miR-765	CLIP-seq
MIRT2145647	hsa-miR-874	CLIP-seq
MIRT2145648	hsa-miR-934	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT2145649	hsa-miR-943	CLIP-seq
MIRT1483798	hsa-miR-2467-5p	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT2145610	hsa-miR-1236	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2366097	hsa-miR-205	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT1483849	hsa-miR-3908	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483803	hsa-miR-4279	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT2145627	hsa-miR-4491	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2145629	hsa-miR-4657	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT2145632	hsa-miR-4711-3p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2145635	hsa-miR-4753-3p	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT2366098	hsa-miR-579	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT2396814	hsa-miR-1208	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT2396815	hsa-miR-2053	CLIP-seq
MIRT2396816	hsa-miR-3143	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT2396817	hsa-miR-4775	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2396818	hsa-miR-569	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT1483817	hsa-miR-106a	CLIP-seq
MIRT1483818	hsa-miR-106b	CLIP-seq
MIRT2145610	hsa-miR-1236	CLIP-seq
MIRT1483819	hsa-miR-1249	CLIP-seq
MIRT2441633	hsa-miR-1292	CLIP-seq
MIRT2441634	hsa-miR-1299	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483820	hsa-miR-1470	CLIP-seq
MIRT2441635	hsa-miR-150	CLIP-seq
MIRT1483824	hsa-miR-17	CLIP-seq
MIRT1483825	hsa-miR-1825	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2366097	hsa-miR-205	CLIP-seq
MIRT1483828	hsa-miR-20a	CLIP-seq
MIRT1483829	hsa-miR-20b	CLIP-seq
MIRT1483830	hsa-miR-2115	CLIP-seq
MIRT1483831	hsa-miR-302a	CLIP-seq
MIRT1483832	hsa-miR-302b	CLIP-seq
MIRT1483833	hsa-miR-302c	CLIP-seq
MIRT1483834	hsa-miR-302d	CLIP-seq
MIRT1483835	hsa-miR-302e	CLIP-seq
MIRT2396816	hsa-miR-3143	CLIP-seq
MIRT1483840	hsa-miR-3194-3p	CLIP-seq
MIRT2441636	hsa-miR-3200-5p	CLIP-seq
MIRT2441637	hsa-miR-339-5p	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT1483844	hsa-miR-3671	CLIP-seq
MIRT1483845	hsa-miR-3687	CLIP-seq
MIRT1483846	hsa-miR-372	CLIP-seq
MIRT1483847	hsa-miR-373	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483855	hsa-miR-4274	CLIP-seq
MIRT1483803	hsa-miR-4279	CLIP-seq
MIRT1483856	hsa-miR-4290	CLIP-seq
MIRT1483857	hsa-miR-4294	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483861	hsa-miR-4442	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT2441638	hsa-miR-4471	CLIP-seq
MIRT2441639	hsa-miR-4477b	CLIP-seq
MIRT2441640	hsa-miR-4481	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2441641	hsa-miR-4682	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2441642	hsa-miR-4745-5p	CLIP-seq
MIRT2441643	hsa-miR-4758-5p	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT2441644	hsa-miR-4782-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483877	hsa-miR-516a-3p	CLIP-seq
MIRT2441645	hsa-miR-516b	CLIP-seq
MIRT1483878	hsa-miR-519d	CLIP-seq
MIRT1483879	hsa-miR-520a-3p	CLIP-seq
MIRT1483880	hsa-miR-520b	CLIP-seq
MIRT1483881	hsa-miR-520c-3p	CLIP-seq
MIRT1483882	hsa-miR-520d-3p	CLIP-seq
MIRT1483883	hsa-miR-520e	CLIP-seq
MIRT1483884	hsa-miR-520g	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2366098	hsa-miR-579	CLIP-seq
MIRT2441646	hsa-miR-607	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT2441647	hsa-miR-670	CLIP-seq
MIRT1483893	hsa-miR-711	CLIP-seq
MIRT1483894	hsa-miR-93	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT2659662	hsa-miR-1224-5p	CLIP-seq
MIRT2659663	hsa-miR-1255a	CLIP-seq
MIRT2659664	hsa-miR-1255b	CLIP-seq
MIRT2659665	hsa-miR-1294	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT2659666	hsa-miR-1915	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2659667	hsa-miR-203	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT2659668	hsa-miR-3121-3p	CLIP-seq
MIRT2659669	hsa-miR-3130-3p	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483838	hsa-miR-3160-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT2659670	hsa-miR-3179	CLIP-seq
MIRT1483841	hsa-miR-3202	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2659671	hsa-miR-3605-5p	CLIP-seq
MIRT1483842	hsa-miR-3616-3p	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483843	hsa-miR-3659	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT2659672	hsa-miR-3929	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT2659673	hsa-miR-4419b	CLIP-seq
MIRT1483859	hsa-miR-4436b-3p	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT2145626	hsa-miR-4476	CLIP-seq
MIRT2659674	hsa-miR-4478	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2659675	hsa-miR-4649-5p	CLIP-seq
MIRT1483865	hsa-miR-4658	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT2659676	hsa-miR-4721	CLIP-seq
MIRT2659677	hsa-miR-4726-3p	CLIP-seq
MIRT1483869	hsa-miR-4728-5p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2145634	hsa-miR-4751	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483885	hsa-miR-542-5p	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT1483890	hsa-miR-574-5p	CLIP-seq
MIRT2441646	hsa-miR-607	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483892	hsa-miR-638	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT2659662	hsa-miR-1224-5p	CLIP-seq
MIRT2659663	hsa-miR-1255a	CLIP-seq
MIRT2659664	hsa-miR-1255b	CLIP-seq
MIRT2659665	hsa-miR-1294	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2659667	hsa-miR-203	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT2659668	hsa-miR-3121-3p	CLIP-seq
MIRT2659669	hsa-miR-3130-3p	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT2659670	hsa-miR-3179	CLIP-seq
MIRT1483841	hsa-miR-3202	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2659671	hsa-miR-3605-5p	CLIP-seq
MIRT1483842	hsa-miR-3616-3p	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT2659672	hsa-miR-3929	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT2659673	hsa-miR-4419b	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT2145626	hsa-miR-4476	CLIP-seq
MIRT2659674	hsa-miR-4478	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2145634	hsa-miR-4751	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483885	hsa-miR-542-5p	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT2441646	hsa-miR-607	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483892	hsa-miR-638	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	16007189
AR	Unknown	23369005
ARNT	Unknown	16774940;19020709
ATF4	Activation	15788408;18829529
ATF4	Unknown	18451308;22915762;23908598
ATM	Repression	20676049
BRCA1	Activation	16543242
COPS5	Activation	12542982
DNMT1	Activation	17934516
E2F1	Repression	20639906
E2F3	Unknown	21372519
EGR1	Activation	20489156
EGR1	Repression	15517885
EGR1	Unknown	9049304
EP300	Activation	22789427
EPAS1	Activation	11301389;11751212;16900513;19080330
EPAS1	Unknown	15156561;16920734
ESR1	Activation	19398483
ESR1	Unknown	10995484;14647449
ESR2	Unknown	10995484
FOXM1	Unknown	21860419
FOXO3	Unknown	21860419
FOXQ1	Activation	20145154
HDAC2	Unknown	23926105
HDAC3	Unknown	23926105
HDAC4	Repression	19509297
HDGF	Activation	14662017;21302807
HEXIM1	Unknown	20453883
HIC1	Repression	24067369
HIF1A	Activation	11749701;12542982;12820439;15315159;15735682;15890092;16052307;16515634;16540671;16854277;16900513;17461470;17557905;17889387;18027712;18060642;18572865;19759417;22789427
HIF1A	Repression	12509854;14712484;15930297;16596228;18471962
HIF1A	Unknown	11486006;15156561;16543242;16774940;17486380;18835464;19238077;19502554;21731766;23060442
HIPK2	Repression	18644116;19046997
HNF1A	Unknown	21731766
HOXB7	Activation	21183939
HTATIP2	Repression	19349353
ID3	Unknown	16926250
JUN	Repression	11731421
KLF4	Unknown	23926105
MEF2C	Unknown	18450586
MYC	Activation	19398483
MYC	Unknown	18809243
NFKB1	Activation	15856023;16684540;17407600;18056465
NFKB1	Repression	15517885
NFKB1	Unknown	12160329;17673602;18184402;20103608;20538607
NKX3-1	Unknown	18974119
NR1H4	Activation	21364590
PGR	Unknown	22542550
PTTG1	Activation	12213878;16926250
RB1	Activation	16007189
RELA	Activation	15856023;16684540;17407600;18056465
RELA	Repression	15517885
RELA	Unknown	12160329;17673602;18184402;20103608;20538607
RUNX1	Repression	21447743
RUNX2	Activation	19509297;22641097
SMAD3	Unknown	11486006
SP1	Activation	10581162;12429844;15217947;15342781;16540671;16982770;21115498
SP1	Repression	11559575
SP1	Unknown	10816575;11731421;12560084;14647449;18575762;23369005;8910439
SP3	Unknown	10816575;14647449
STAT3	Unknown	23104276
STAT3	Activation	11960372;15735682;17169602;17533737;19284568;19880237;21278793;21418908
STAT3	Repression	17533737;19880237;22313388
STAT3	Unknown	12824281;16540670;16899623;17937859;18184402;18320073;19020709;20043094;21172343;21344490;21731766;25101566
TCF4	Activation	15940626
TEAD4	Repression	22761647
TFAP2A	Activation	9049304
TFAP2A	Unknown	11731421
TP53	Activation	16684540
TP53	Repression	11559575
TRAF6	Repression	22326918
UHRF1	Unknown	17934516
VHL	Activation	10804089;7533661;8625303
VHL	Repression	10581162;12539169;12912922;8855222;9370235
VHL	Unknown	10189987;19801654;9572397;9689663
WT1	Activation	20871039
WT1	Unknown	16572586;17127464
XBP1	Unknown	20824063
ZFP36	Repression	21507959;21656745
ZFP36L1	Repression	19801654
ZNF24	Repression	20510677;23212515

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18093989
GO:0001525	Process	Angiogenesis	IDA	11427521, 21771332
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001568	Process	Blood vessel development	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IMP	23688497
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IMP	23083510, 23688497
GO:0001570	Process	Vasculogenesis	TAS	15015550
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IDA	16490744
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	19033661
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	12714610
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	9202027, 10022831, 16489009, 18577655, 20497126, 31915155
GO:0001938	Process	Positive regulation of endothelial cell proliferation	ISS
GO:0001944	Process	Vasculature development	IEA
GO:0001946	Process	Lymphangiogenesis	IEA
GO:0001968	Function	Fibronectin binding	IDA	14570917
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	20660291
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002070	Process	Epithelial cell maturation	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IDA	20660291
GO:0002376	Process	Immune system process	IEA
GO:0002575	Process	Basophil chemotaxis	IDA	17082651
GO:0002687	Process	Positive regulation of leukocyte migration	TAS	1312256
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003007	Process	Heart morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003169	Process	Coronary vein morphogenesis	ISS
GO:0005125	Function	Cytokine activity	IDA	18440775
GO:0005125	Function	Cytokine activity	ISS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	17470632
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IPI	9529250, 10471394, 11513746
GO:0005515	Function	Protein binding	IPI	1312256, 1417831, 9393862, 10543948, 16763549, 17222790, 17446437, 20145116, 20660291, 21596751, 21653826, 22020326, 22897854, 23374253, 23583373, 25825981, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9202027, 16490744
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	17082651
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005912	Component	Adherens junction	IDA	26598555
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	18093989
GO:0006915	Process	Apoptotic process	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	18059339
GO:0007399	Process	Nervous system development	TAS	15351965
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0007498	Process	Mesoderm development	ISS
GO:0007595	Process	Lactation	IEA
GO:0007595	Process	Lactation	ISS
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	9202027, 20497126
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	ISS
GO:0008201	Function	Heparin binding	IDA	15001987
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	IMP	14570917
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7929439
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26268439
GO:0008360	Process	Regulation of cell shape	IDA	7929439, 10527820
GO:0009986	Component	Cell surface	IDA	17470632
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	10022831, 19033661, 31915155
GO:0010628	Process	Positive regulation of gene expression	IDA	22696064
GO:0010629	Process	Negative regulation of gene expression	IDA	22773844, 28977001
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	19148554
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010749	Process	Regulation of nitric oxide mediated signal transduction	IDA	16150726
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030141	Component	Secretory granule	IDA	17082651
GO:0030154	Process	Cell differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IDA	21149635
GO:0030225	Process	Macrophage differentiation	IDA	21149635
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	20497126
GO:0030324	Process	Lung development	IEA
GO:0030324	Process	Lung development	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	7929439, 17470632
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0031012	Component	Extracellular matrix	NAS	14570917
GO:0031077	Process	Post-embryonic camera-type eye development	IEA
GO:0031077	Process	Post-embryonic camera-type eye development	ISS
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	ISS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	16489009, 19033661
GO:0031954	Process	Positive regulation of protein autophosphorylation	IDA	17470632
GO:0035148	Process	Tube formation	IDA	19033661
GO:0035767	Process	Endothelial cell chemotaxis	IDA	18440775, 21245381
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	18440775, 20497126
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0036303	Process	Lymph vessel morphogenesis	ISS
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	IMP	23688497
GO:0038033	Process	Positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IDA	31915155
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IDA	16774925, 20660291, 23639442, 30496354
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IMP	19148554, 23083510
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	NAS	23878390
GO:0038091	Process	Positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway	IDA	17470632
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	IMP	24863063
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	ISS
GO:0038191	Function	Neuropilin binding	IPI	24401374
GO:0040008	Process	Regulation of growth	IEA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042056	Function	Chemoattractant activity	IDA	17082651, 18059339, 18440775, 19275959, 20497126, 21245381
GO:0042056	Function	Chemoattractant activity	IEA
GO:0042056	Function	Chemoattractant activity	ISS
GO:0042311	Process	Vasodilation	IEA
GO:0042462	Process	Eye photoreceptor cell development	IEA
GO:0042462	Process	Eye photoreceptor cell development	ISS
GO:0042802	Function	Identical protein binding	IPI	1312256, 12207021, 22897854, 25132001
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10066377, 11461089
GO:0043117	Process	Positive regulation of vascular permeability	IDA	16109918, 26598555
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	NAS	23878390
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0043129	Process	Surfactant homeostasis	ISS
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IPI	1312256
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	1417831, 10022831, 20660291, 25825981
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	18440775, 31915155
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	9202027, 18440775, 20497126
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	23688497
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045601	Process	Regulation of endothelial cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	18440775, 18577655, 19033661, 20497126, 22773844
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	18275976
GO:0045785	Process	Positive regulation of cell adhesion	IDA	19674970
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18059339, 18093989, 20497126
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18093989, 19652095
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	1312256, 7929439, 18059339, 18440775, 21245381, 23639442, 31915155
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	20497126
GO:0048018	Function	Receptor ligand activity	IMP	23083510
GO:0048018	Function	Receptor ligand activity	IPI	17470632, 20660291
GO:0048469	Process	Cell maturation	ISS
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0048593	Process	Camera-type eye morphogenesis	ISS
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	IEA
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	ISS
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	16489009
GO:0050840	Function	Extracellular matrix binding	IC	14570917
GO:0050918	Process	Positive chemotaxis	IDA	20497126
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050918	Process	Positive chemotaxis	ISS
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	7929439, 12744932
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0050930	Process	Induction of positive chemotaxis	NAS	12744932
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	16489009
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	30496354, 31915155
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	30496354, 31915155
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	24863063
GO:0055013	Process	Cardiac muscle cell development	IEA
GO:0055013	Process	Cardiac muscle cell development	ISS
GO:0060319	Process	Primitive erythrocyte differentiation	IEA
GO:0060319	Process	Primitive erythrocyte differentiation	ISS
GO:0060346	Process	Bone trabecula formation	IEA
GO:0060426	Process	Lung vasculature development	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060749	Process	Mammary gland alveolus development	ISS
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:0060948	Process	Cardiac vascular smooth muscle cell development	ISS
GO:0060982	Process	Coronary artery morphogenesis	ISS
GO:0061042	Process	Vascular wound healing	IMP	23688497
GO:0061430	Process	Bone trabecula morphogenesis	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	23639442
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	24863063
GO:0071456	Process	Cellular response to hypoxia	IDA	10575000
GO:0071456	Process	Cellular response to hypoxia	IMP	19652095
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	ISS
GO:0071679	Process	Commissural neuron axon guidance	IEA
GO:0071679	Process	Commissural neuron axon guidance	ISS
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IDA	18059339, 20551324
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IGI	24844779
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	23083510, 24865854
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:0097475	Process	Motor neuron migration	IEA
GO:0097475	Process	Motor neuron migration	ISS
GO:0097533	Process	Cellular stress response to acid chemical	IDA	26299712
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26683794
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IDA	23688497
GO:1901165	Process	Positive regulation of trophoblast cell migration	IMP	23083510
GO:1901492	Process	Positive regulation of lymphangiogenesis	IEA
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	NAS	23878390
GO:1902966	Process	Positive regulation of protein localization to early endosome	IDA	23639442
GO:1903141	Process	Negative regulation of establishment of endothelial barrier	IDA	20048167
GO:1903392	Process	Negative regulation of adherens junction organization	IDA	26598555
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	24844779
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	30106099
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	26299712
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IGI	25251394
GO:1905278	Process	Positive regulation of epithelial tube formation	IDA	31915155
GO:1905555	Process	Positive regulation of blood vessel branching	IDA	20123964
GO:1905604	Process	Negative regulation of blood-brain barrier permeability	IMP	19148554
GO:1990150	Component	VEGF-A complex	IPI	12207021
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	26598555
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IDA	16774925
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IGI	16774925
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IDA	20497126

Other IDs

• MIM: 192240
• HGNC: 12680
• e!Ensembl: ENSG00000112715

Protein

• UniProt ID: P15692
• Protein name: Vascular endothelial growth factor A, long form (L-VEGF) (Vascular permeability factor) (VPF) [Cleaved into: N-VEGF; VEGFA]
• Protein function: [N-VEGF]: Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed:35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity). {ECO:00
• PDB: 1BJ1, 1CZ8, 1FLT, 1KAT, 1KMX, 1MJV, 1MKG, 1MKK, 1QTY, 1TZH, 1TZI, 1VGH, 1VPF, 1VPP, 2FJG, 2FJH, 2QR0, 2VGH, 2VPF, 3BDY, 3P9W, 3QTK, 3S1B, 3S1K, 3V2A, 4DEQ, 4GLN, 4GLS, 4KZN, 4QAF, 4WPB, 4ZFF, 5DN2, 5FV1, 5FV2, 5HHC, 5HHD, 5O4E, 5T89, 6BFT, 6D3O, 6T9D, 6V7K, 6Z13, 6Z3F, 6ZBR, 6ZCD, 6ZFL, 7KEZ, 7KF0, 7KF1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	52 → 130	PDGF/VEGF domain	Domain
  PF14554	VEGF_C	180 → 232	VEGF heparin-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Higher expression in pituitary tumors than the pituitary gland. {ECO:0000269|PubMed:22009797}.; TISSUE SPECIFICITY: [Isoform VEGF189]: Widely expressed.; TISSUE SPECIFICITY: [Isoform VEGF165]: Widely expressed.; TISSUE SPECIFICITY: [Is
• Sequence:

  MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
  IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
  SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
  PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

• Sequence length: 232

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
VEGFA-related disorder	Likely pathogenic	rs2533253817	RCV003397759	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, PANCREATIC DUCTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOROIDAL NEOVASCULARIZATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR-CELL METASTATIC RENAL CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLICATIONS OF DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF CARTILAGE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL NEOVASCULARIZATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, TREATMENT-RESISTANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES COMPLICATIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PORTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microvascular complications of diabetes, susceptibility to, 1	Benign	ClinVar CTD, ClinVar CTD, ClinVar	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOCHONDRODYSPLASIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORTAL HYPERTENSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLOGIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	23553563	Associate	★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	10893358, 21242666, 31189189		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	17721409, 21800959, 25692621, 25738867, 27819721, 29309662		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	24092547		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	29198900, 30954486		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17264508, 29551453, 30111293		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	14712314		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	20943766, 22808199		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	17031469, 21209384, 23503608, 24966925, 30378769		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12915891, 16146532, 17011029, 21732038, 22417860, 28550041, 30534565, 30896872		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19342098, 20567828, 28636974, 30106099, 30417360, 30909668		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	30551453		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28730233, 29200137		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10772888, 12760284, 16465716, 26099922		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	17298169		★☆☆☆☆ Found in Text Mining only
Adams-Oliver syndrome 1	Adams-Oliver Syndrome	BEFREE	29545927		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10362127, 10738243, 11102890, 11299793, 12367793, 12377649, 12448000, 12579092, 12596060, 12684660, 14981918, 15289739, 15498380, 15522212, 15870864, 16140938, 16804907, 17785951, 17852856, 18414651, 19324448, 20489156, 21635552, 22198428, 22287745, 23030255, 23441128, 24367507, 25484066, 25773840, 25875799, 26525902, 26782587, 27876017, 29025597, 29970531, 31035945, 31044389, 31572671, 9683299, 9701011, 9815567, 9816315		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11920479, 12568850, 15173661, 15522212, 16702519, 16972327, 16984727, 18032824, 18414651, 18450321, 18780893		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20414936, 23536895, 26824338		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	10416597, 12579092, 15958546, 16702519, 16984727, 18780893, 22258871, 24206575, 26014353		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15498380, 15522212, 17785951, 18936210, 21635552, 30517845		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10741721, 11679938, 15086970, 15289739, 17560552, 18450321, 19337377, 20489156, 20941554, 21115742, 21333376, 21436589, 21978170, 23549264, 24283983, 25912305, 25937533, 26782587, 27940520, 29434991, 29767258, 30008907, 30254466, 30323681, 30972298, 31798347		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11358838, 12464871, 12488200, 12553038, 15026340, 16244806, 20495549, 21224502, 22082308, 23689123, 23719599, 27637085, 28338114		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11299793, 29137361, 29544697, 7545086		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	LHGDN	19121088		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	23464458, 28574932		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	24456477, 24510998, 26194375, 30945361		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11414477, 11584965, 11669335, 12590639, 12754739, 16555551, 19172414, 19697322, 22158497, 28110235		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	16283008, 18172354		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15498380, 16555551, 20857215, 23508981, 23996743, 29556334		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	12810642, 19423615		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	15522906		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	11605159, 12780519, 14659975, 16954163, 19017755, 22183643, 23106811, 25973039, 28264974, 28423608		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16146532, 22417860, 28550041, 30534565		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	22664115, 23157271, 29137304		★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	24608455, 29952957		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22129133, 22882209, 23020605, 28326867		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	21853101, 25147179		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	20801723		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20883786, 23082872, 25794107, 28302031, 31063715		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	28469969, 9669344		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11555584		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	29216907, 30142763, 30657097		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	10849558, 10880384, 11748590, 12597922, 12778165, 14566975, 15294883, 15808152, 16384981, 16735996, 16940309, 18079689, 18368052, 18378209, 18633446, 18708255, 19689408, 19761764, 19768732, 19800536, 19896188, 19909248, 20019880, 20471686, 20678803, 20683548, 20847577, 20887247, 20890966, 21158586, 21282580, 21374591, 21386905, 21558292, 21744122, 21830945, 21858763, 21881842, 22307787, 22309197, 22312192, 22355348, 22521084, 22618592, 22694956, 22840423, 23030506, 23080553, 23341606, 23569009, 23745581, 23761723, 23795287, 23818759, 23971975, 24012762, 24021586, 24080590, 24157918, 24303777, 24365177, 24522370, 24689893, 24812550, 24995509, 25050486, 25125423, 25306972, 25432081, 25457617, 25524721, 25558172, 25903050, 26028346, 26161984, 26330749, 26427397, 26654980, 26705092, 26780119, 26923802, 26974308, 27069359, 27349759, 27404493, 27434329, 27503396, 27517154, 27599360, 27810736, 27840917, 27913654, 27918307, 27999450, 28006042, 28062400, 28107458, 28151839, 28154252, 28236576, 28546942, 28557591, 28585908, 28621038, 28679845, 28723848, 28750559, 28817343, 28866675, 28887057, 28926193, 28926846, 28947815, 28964579, 29061629, 29068914, 29111834, 29150277, 29193961, 29196745, 29196768, 29197628, 29211782, 29367644, 29446046, 29484106, 29533953, 29565837, 29721663, 29721978, 29734810, 29769445, 29852030, 29852193, 29864423, 29902977, 30028411, 30048978, 30082848, 30103950, 30157273, 30200369, 30289322, 30301555, 30328441, 30534004, 30535424, 30594908, 30825671, 30842468, 30844038, 30851267, 30959236, 30986797, 31055948, 31080113, 31132283, 31173913, 31286206, 31294771, 31317354, 31399890, 31436780, 31454678, 31456444, 31615077, 31617403, 31633290, 31644596, 31669558, 31743875, 31766318, 31768932		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	CTD_human_DG	15788408		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	16384981, 16940309, 18079689, 18378209		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	20801723		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19317804, 24456477, 24510998, 26194375		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	18702899, 24717944, 31586492		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	16077930		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	21552147, 31502400		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21931866, 25751166, 29848382, 29851783, 31332262, 32980851, 33186918, 35347084, 36680854, 36905877, 37009506, 37047617, 37385335, 37596325, 38160360, 39385222	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	23182805	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	31791659, 34845413	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	11896820		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	33067558	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid nephropathy	Amyloid Nephropathy	BEFREE	17994443		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	17522146	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	17522146, 23438977, 24257464, 8738799		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	17522146	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis familial visceral	Visceral amyloidosis	Pubtator	17994443	Associate	★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	23438977		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12847526, 14556945, 15164063, 15177192, 15184633, 15389897, 15568021, 15763997, 15899498, 16301836, 16410746, 16421133, 16569480, 16753977, 16784838, 16843725, 16856151, 17142042, 17215390, 17257729, 17456229, 17538775, 17636250, 17854437, 18413368, 18759352, 19196430, 19626053, 21864053, 21906274, 23368766, 23712039, 24177067, 24471417, 24509642, 25239623, 25801576, 26551617, 27495938, 27617773, 28163215, 28452633, 28570669, 28831083, 29497380, 29751031, 30114551, 30283455		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	12847526, 15568021, 15776280, 16410746, 17215390, 17538775		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	16421133	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	17456229, 19196430, 26210997, 29702606, 40097075	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	21906274, 32586411	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	18608101		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14981918, 22693250, 29044176, 30522724		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10741908, 12356354, 12702589, 15175080, 18498284, 19732454, 28000842		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	24353325, 9669344		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17019708, 26286966, 27067785, 30272291, 30544959, 31545405		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30406853, 30706812		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	31478937		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	15756443		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	16827797, 35090332	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	25310988, 26254223		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	16400015, 19154660	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	20348277	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	20443870	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10339489, 12111782	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	28832635, 32352161, 32411797	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	17934349, 18080800, 22925497, 25130874, 27636225		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	15274325	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23746831	Associate	★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	15347709	Inhibit	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	23421785	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	15331549		★☆☆☆☆ Found in Text Mining only
Angioid Streaks	Angioid streaks	BEFREE	30260918		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	15311211, 18006812, 19120365, 22322190		★☆☆☆☆ Found in Text Mining only
Angiokeratoma	Angiokeratoma	BEFREE	23332617		★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	10830746, 28183278, 28699668, 31012139, 31264312		★☆☆☆☆ Found in Text Mining only
Angioma	Angioma	BEFREE	20393000, 23075102, 23357661, 29327758		★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	BEFREE	23398358, 23651727		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	24061003		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	40570009	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	16014410, 27369645, 27637764, 28941122, 30306221, 31533751, 31726387		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28578351	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	11291072, 24975163, 25527450, 26261495, 28352075, 28377069, 28916756, 28984028, 31512195		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	30355978		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anoxia-Ischemia, Brain	Anorexia	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Anoxia-Ischemia, Cerebral	Anorexia	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Anoxic-Ischemic Encephalopathy	Anoxic-Ischemic Encephalopathy	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	39354436	Stimulate	★☆☆☆☆ Found in Text Mining only
Anterior Ischemic Optic Neuropathy	Anterior Ischemic Optic Neuropathy	BEFREE	28431433		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	16968331	Stimulate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	31776047	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	21436157, 28791384		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24657063	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	27720318	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	35563123	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20471768, 21436157, 24657063, 30614051, 31294623		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	28791384		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic disease	Pubtator	35922433	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	22683047		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	14760594	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	19062173, 27196763		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	18718425	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	36820574	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19317804, 24456477, 24510998, 26194375		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	28303517, 30230583		★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Apparent Mineralocorticoid Excess	BEFREE	21434579		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	15155530, 16298089		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	32022379	Inhibit	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11156961, 11529880, 12628953, 15520188, 15937083, 16129816, 16276035, 16569480, 16999951, 17227476, 19037583, 19047582, 19089753, 19148342, 20500895, 21737794, 22064697, 22683047, 23102786, 23559636, 23839109, 24657063, 25613580, 26959822, 27704620, 28506859, 28646427, 28748694, 30041762, 30061319, 30125282, 30233664, 31006671, 31016760, 31571264, 9201024, 9672081, 9815864		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	25839219	Associate	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	20019187, 28325846, 31026826		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	30420902	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10820274, 14528319, 17237427, 17543159, 22898216, 26922678, 26947206, 30420902, 31234583, 8006592, 9933439		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	11592363, 28765881, 30420902, 33958655, 34918882	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17543159		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	12653578	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	38166934	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16741508, 17204151, 22283733, 23303013, 27706699, 30181004	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17204151	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	24146263, 31864394, 37979213, 7615975, 8064230, 9049304	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10337031, 10971521, 11710707, 12384916, 12847684, 16519794, 17530707, 18721452, 19176759, 19883500, 21179282, 22866899, 23684916, 24309559, 25894998, 26825024, 27513931, 28067317, 29327326, 30314410, 30767867, 32561292, 33977746, 34385542, 36435778, 37174663, 37175591, 37298499, 37669474, 37975481, 9539788, 9620225	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12823854, 27513931, 32840301, 35653890, 38081836, 7531945, 8006592	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12563678, 17204151, 17543159		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	10820274, 15213335		★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	12592265, 30304094		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11398081, 14633511, 16461129, 16555282, 16630933, 16961715, 17406066, 17906365, 18188016, 19196819, 19479364, 21517900, 21595947, 22519966, 22689881, 23391391, 24152156, 26996348, 27173321, 27579513, 27842724, 28056993, 28635361, 29176061, 30076648, 30574871, 30740942, 31586488, 31586492, 31831011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	11907124, 15201500, 19263519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	14633511, 15201500, 16461129, 16645174, 17168735, 17651148, 18298425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	14633511, 15665043, 19196819, 22461367, 22689881, 27173321, 27336865, 27579513, 28056993, 30574871, 30740942, 31524265, 31586488, 32526308, 33626956, 35069542, 35751199, 37240226, 38253462, 39766875	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23845883	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10074901, 10077162, 10778727, 11058875, 11303624, 11305411, 11908876, 12356354, 1279432, 12960698, 14603252, 15175080, 15453096, 16244591, 22542550, 26701969, 27882487, 28281545, 28418872, 28837676, 8835763, 9669344		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	11783119, 15973775, 16773219		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12356354, 20052595, 28281545	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12937144, 15973775, 16900782, 23338113, 8835763	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26189429, 26820153	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	31510873		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 1	Atelosteogenesis	Pubtator	24353325	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10731922, 14990597, 15937083, 16085213, 18270456, 19148342, 19176759, 21757650, 26959822, 27704620, 30041762, 33942489, 35052452, 35365727, 37880698, 39201353, 7843420, 9137092	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11156961, 11529880, 15520188, 15937083, 16129816, 16276035, 16569480, 16999951, 17227476, 19037583, 19047582, 19089753, 19148342, 20500895, 21737794, 22064697, 22683047, 23102786, 23559636, 23839109, 24657063, 25613580, 26959822, 27704620, 28506859, 28646427, 28748694, 30041762, 30061319, 30125282, 30233664, 31006671, 31571264, 9201024, 9672081, 9815864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	15937083		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	16999951, 17141247, 18270456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20631454, 21954878, 28397441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	20631454	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	29214007		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	29214007		★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	Pubtator	23040494	Associate	★☆☆☆☆ Found in Text Mining only
Atrophoderma maculatum	Anetoderma	BEFREE	28231837, 28723848, 30301555, 30589663, 31843790		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	25751166, 28231837, 34721402, 37861555	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28405874, 31170860, 31671489		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29214007		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11110694, 26955881	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17696908	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25596346, 25641412, 26955881, 27246981, 29980767, 31135085		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	19107589, 40215689	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17392174, 18282597		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19120365, 26026079, 27740975, 28358700, 28412388, 28416308, 28418864, 28781641, 28912871, 29104621, 29113197, 29134229, 29152647, 29207094, 29495429, 29750888, 30017933, 30255981, 30426692, 31189740, 31222746, 31312367, 31632589, 31658318		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11050001, 14996703, 17018398, 19965686, 23335070, 25966180		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	17383815		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	16702519		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	12579092, 17852856, 22147251		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	12579092, 31363321	Associate	★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	12660426, 14708636		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15338501, 16386649, 19054372, 19493574, 30015524, 30420902, 30919148		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	15338501		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	29854829, 30420902, 34918882	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	12368197, 19253105, 28574932, 8667614		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	18494554		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	BEFREE	28691414		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21965736, 28506859, 29279353, 29391897, 29441606, 29563805, 30186533, 31383249		★☆☆☆☆ Found in Text Mining only
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	Bestrophinopathy	BEFREE	16973968		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	29061162		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	29061162	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	29061162		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	21095332		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	21481422	Associate	★☆☆☆☆ Found in Text Mining only
Bietti Crystalline Dystrophy	Bietti crystalline corneoretinal dystrophy	Pubtator	32799831	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	19713864, 26510548, 28710035, 29251369		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	29251369	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	20530271, 24123039, 27849649, 28668864		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	23057767, 26179201	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21721043		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21721043, 23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder neck obstruction	Bladder neck obstruction	BEFREE	20152373		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11350893, 11953885, 11980898, 12776187, 15667866, 15947684, 16914569, 17319747, 17628298, 18425331, 18513850, 18645275, 19088043, 19190164, 19424629, 20978160, 21292509, 21632885, 22453067, 23009795, 23243026, 23430447, 23613251, 23749886, 23908596, 24402583, 24448324, 25792473, 26197083, 26544730, 27196763, 28109084, 28206971, 28209239, 28423532, 28687357, 28710377, 29277778, 29959793, 30195633, 30533316, 30609111, 30655756, 30849545, 30909190, 31231785		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11980898, 17319747, 18425331		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	18534064	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	18534064, 25831205, 26502845		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	22457763	Associate	★☆☆☆☆ Found in Text Mining only
Blindness, Legal	Blindness	BEFREE	22312192		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	7738351	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	28572048		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	30781507	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	15613012	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	32234826	Stimulate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	20685877	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	23500833		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	25894998, 29149180, 36147560, 36967561	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	29518117	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	24890946, 31042345, 32383346	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone neoplasm	Pubtator	19154660	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	25644713	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25278075	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18420967, 22394267		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	31156438		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18854444, 26908328, 36426373	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	21968684, 22420586, 25821815, 34815366	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	21737794, 23559636		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	37047617	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	24067772, 37047617	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	11029398, 11279416, 24251624, 31715125	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	11029398, 14981457, 15770733, 17698375, 27951596, 30539420	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	15347709	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	20587967, 28460604, 31715125		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10215998, 10451490, 11059786, 11409526, 11912165, 12712432, 15175080, 15949234, 16523449, 16804907, 17570036, 21979892, 22158497, 26951556, 27325687, 27882487, 28059647, 28110235, 28691414, 28948065, 29941486, 30062604, 30629215, 7528359, 7532545, 8910439, 9751633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	LHGDN	15949234, 16036113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	20932960		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	28691414	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	28948065, 29110584, 30451357, 31527824, 36435833, 8910439	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	23232696, 23326384		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10375015, 10607018, 10744622, 10967114, 11156525, 11175850, 11245489, 11280795, 11306513, 11336478, 11479209, 11559575, 11571649, 11793372, 11899364, 11929808, 12114428, 12208749, 12378509, 12581744, 12591731, 12736564, 12845639, 12851730, 14500350, 14520689, 14660675, 14695189, 14715109, 14726684, 15014023, 15026804, 15168728, 15173272, 15179031, 15274325, 15280403, 15519527, 15592523, 15609122, 15609132, 15736439, 15860260, 15871723, 15894927, 15897560, 15949894, 15958542, 16084894, 16267616, 16322245, 16397053, 16613616, 16671089, 16775174, 16954424, 16978872, 16985052, 17010208, 17085437, 17471570, 17550303, 17636397, 17695512, 17698375, 17891484, 18171601, 18568347, 18570923, 18630531, 18671839, 18790743, 18821062, 18824714, 18825410, 18987982, 19162240, 19196101, 19226458, 19242105, 19283869, 19340614, 19398483, 19429439, 19553068, 19671742, 19766100, 20112503, 20307196, 20449668, 20563637, 20571871, 20631064, 20652396, 20686367, 20714802, 20830515, 20848232, 20876703, 20971063, 21119072, 21127992, 21193031, 21194429, 21204912, 21233846, 21249429, 21284259, 21291529, 21546870, 21673995, 21731759, 21734015, 21798757, 21927028, 21984182, 22000946, 22095586, 22237711, 22258476, 22315135, 22542663, 22561350, 22644871, 22800822, 22907703, 22993299, 23000338, 23054001, 23092556, 23123638, 23146280, 23203097, 23212515, 23254958, 23289900, 23390884, 23625573, 23631762, 23679262, 23695548, 23711825, 23725153, 23728336, 23750285, 23752185, 23832257, 23846253, 23904001, 23907365, 23926105, 23981902, 23991063, 24265228, 24357345, 24377619, 24390659, 24401996, 24464787, 24528036, 24535190, 24595984, 24615579, 24659092, 24680191, 24687553, 24816918, 24839112, 24875759, 25106408, 25148899, 25152223, 25230850, 25281903, 25333258, 25412937, 25448984, 25560472, 25579062, 25604142, 25620657, 25772243, 25972323, 26052072, 26067906, 26080815, 26100253, 26173622, 26239613, 26287601, 26345822, 26416045, 26805761, 26848522, 26882471, 26919112, 26988756, 27107086, 27195611, 27323060, 27362808, 27649142, 27771839, 27775427, 27988457, 28045923, 28051026, 28062977, 28119364, 28163094, 28183251, 28220020, 28240006, 28252641, 28274247, 28333356, 28443023, 28476037, 28509606, 28534941, 28550685, 28558368, 28606050, 28615679, 28643744, 28652379, 28697175, 28714000, 28741069, 28744693, 28752859, 28780387, 28860767, 29069797, 29088842, 29100335, 29115538, 29136509, 29137038, 29179185, 29221123, 29230610, 29340882, 29367761, 29391899, 29403376, 29434864, 29497310, 29699375, 29705024, 29717062, 29730399, 29874563, 29970508, 29970908, 29971782, 30003393, 30008856, 30063723, 30105032, 30259245, 30314513, 30405852, 30439625, 30594607, 30629215, 30722112, 30788837, 30818220, 30867566, 30888194, 30930461, 30939479, 30947677, 31023337, 31028743, 31228519, 31254605, 31635541, 31746369, 31824163, 7821921, 8616842, 8619189, 9426694, 9458078, 9495238, 9542512, 9828838		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	12736564		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	29955134	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10360672, 10496346, 10551327, 10574263, 11336478, 11556826, 12087467, 12105188, 12115372, 12918061, 14660675, 14680499, 14738568, 15274325, 15297858, 15736439, 15816564, 16080568, 16084894, 16312046, 16398404, 16403812, 16528367, 16543242, 16613616, 16633004, 17353919, 17407600, 17695512, 17698375, 17972522, 18366667, 18508268, 18554584, 18568347, 18630531, 18676847, 18758633, 18824714, 18825410, 18922978, 19047117, 19129556, 19129951, 19283869, 19349962, 19489979, 19553068, 19569175, 19919679, 20112503, 20204402, 20571871, 20848232, 20981515, 21119072, 21204912, 21233846, 21234673, 21291529, 21390493, 21546870, 21665940, 21666711, 21671140, 21860419, 21980400, 22116346, 22174163, 22200869, 22524830, 22581182, 22644676, 23079576, 23232696, 23289900, 23326384, 23340303, 23390884, 23422754, 23631762, 23667446, 23725153, 23832257, 23886210, 23926105, 24335179, 24377619, 24528036, 24595984, 24606439, 24687553, 24941346, 24965403, 25031741, 25106408, 25333258, 25379550, 25448984, 25449683, 25550468, 25556440, 25604142, 25714853, 25824321, 26052072, 26173622, 26312763, 26472724, 26842181, 27135253, 27195611, 27340922, 27771839, 28045923, 28051026, 28252641, 28476037, 28550685, 28652379, 28744693, 28752859, 29108569, 29109792, 29137038, 29212519, 29241196, 29699375, 29901696, 29971782, 30063723, 30087366, 30412123, 30420728, 30451357, 30476925, 30678431, 30814616, 30866857, 30930461, 31619709, 31963833, 31983176, 32070401, 32127237, 32871794, 33187481, 33219203, 33256829, 33446741, 33628590, 33639684, 33751828, 33754901, 33801351, 34221232, 34429108, 34636027, 34638797, 34731130, 34793664, 34928481, 35668376, 36617773, 36674696, 36873124, 36913368, 37176055, 37764312, 38012382, 39302921, 39337657, 39684488, 40343434, 7525523, 9649123, 9820181	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15113858, 18715621, 22982376, 23534767, 23750285, 23981902, 26456994, 32108136	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	19664288	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	24152156		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	30696477, 30706940		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	11804877		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	17631682		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	LHGDN	17631682		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	21306579	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	17968307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis, Chronic	Gastric Cancer	CTD_human_DG	19263519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	16230500, 18420967, 18614962, 22394267, 24662923, 24874013, 25998098, 26172140, 29393249, 29638228, 29687638		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	18420967, 20826912, 24662923, 36092960, 37272765	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	15003169		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	7738351		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16288493, 18396013, 21473291		★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	23007311		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	24474253		★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	16499871		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	16139912, 30430078		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	16499871		★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	CTD_human_DG	23009795		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11141500, 12070140, 12213806, 14669355, 18806258, 19300368, 20205278, 20712888, 21119072, 21224502, 21424698, 22205725, 22558473, 25523098, 27982164, 28347226, 28415573, 28520992, 28720067, 29137038, 29959793, 30070315, 30476925, 30965236, 31432165, 31752829, 32074192, 32466535, 33108070, 33682749, 33888009, 35292059, 39412903	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15517881	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26325091	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	23339006	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	9683299	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10188906, 10194527, 10475065, 10569799, 10675482, 10760758, 11306510, 11669335, 11687953, 11764385, 11804750, 12208766, 12209972, 12218216, 12298426, 12596060, 12890841, 12939742, 15475936, 15517881, 15522906, 15616600, 15777969, 15919761, 16144770, 16555551, 16641910, 16648098, 16847924, 17346539, 18408656, 18485799, 19223090, 19250857, 20818432, 23845470, 23996743, 24185122, 25575132, 28174788, 28864539, 29617404, 29854307, 31169001, 31198634, 7478581, 8616842, 9635853, 9701011		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	37185612	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	17543095, 19317804, 26194375, 30945361, 36281584	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	20690417, 28961428	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	11092527	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	22895562, 24902660, 25181405, 25261667	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	18758633, 22894137, 27903846, 40042161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21606203, 22174163, 24022309, 37975220	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	22944067	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	34256796	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10636104, 10741909, 10888784, 11115828, 11176129, 14991930, 14991937, 15040022, 15133868, 15460907, 15633213, 15742396, 15786555, 15800977, 15991282, 16038047, 16094704, 16627984, 16650286, 16775432, 16830384, 19104702, 19177438, 19414323, 19777619, 19821965, 19944696, 19948069, 20461183, 21564420, 21574155, 22161247, 22178269, 22553402, 23756865, 24045661, 24330582, 24495874, 24587407, 25031711, 25071074, 25283528, 25572735, 25723613, 25908103, 26165487, 26612965, 26783726, 27173353, 27982164, 28147320, 28358369, 28485347, 28642869, 28713927, 28741166, 28837651, 28975984, 29739298, 29854577, 30362374, 30738047, 30935424, 31179333, 31415486, 31726461, 32641699, 33223512, 33647018, 33673041, 33846786, 33954191, 33960267, 33989451, 34076988, 34206143, 34644732, 34845413, 35140333, 35169858, 35205327, 35493459, 35567547, 35634309, 35722791, 36068200, 36102438, 36157115, 36157928, 36303180, 36308081, 36578460, 36660950, 36729917, 37248280, 37688769, 37904170, 38179744, 39777758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15334691, 15655835, 18193117, 18300343, 18701503, 23091809, 23485556, 36853298	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31450899	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	16613616	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18384688	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	22231433, 32506171	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	17115023, 18408656	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	17342767, 21948244	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	37175975	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11350893, 11953885, 11980898, 15667866, 15947684, 16914569, 17319747, 17628298, 18425331, 18513850, 19088043, 19190164, 19424629, 20978160, 21292509, 21632885, 23009795, 23243026, 23430447, 23613251, 23749886, 24402583, 24448324, 25792473, 26197083, 26544730, 27196763, 28109084, 28206971, 28209239, 28423532, 28687357, 28710377, 29277778, 29959793, 30195633, 30533316, 30609111, 30655756, 30849545, 30909190, 31231785, 9823778		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	15739081, 27927251		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10675482, 10918604, 11092527, 11589304, 12136423, 12576459, 12736723, 12845630, 15767331, 17024232, 17044926, 17505039, 17671719, 17906365, 18281657, 18359110, 19223090, 19291283, 19324447, 19337377, 19339077, 19509262, 19853959, 20027628, 20187798, 20208480, 20489156, 20497582, 20712888, 21283766, 21333372, 21610170, 21712447, 21785819, 21854359, 22231433, 22236877, 22320189, 22431315, 22789825, 22795057, 23275310, 23288726, 23462173, 23665907, 23982876, 24008975, 24098368, 24146275, 24647869, 25125500, 25184262, 25335740, 25425729, 25468805, 25773840, 25889301, 25912305, 26065377, 26094984, 26406951, 26542886, 27364335, 27423680, 27541266, 27709850, 27930983, 27981753, 28122267, 28335793, 28339070, 28356976, 28626164, 28656083, 28720067, 28749108, 28831824, 28861767, 29434884, 29675110, 29775813, 29904944, 29928404, 29983647, 30013987, 30222960, 30518184, 30539834, 30563405, 30682194, 30807551, 31059086, 31091971, 31516609, 31559061, 31572671, 31764844, 31770191, 9683299, 9816315, 9863024		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	19664288		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16124061, 19240722, 23202951, 24986540, 25092217, 26098087, 26143638, 26158818, 26264619, 27118139, 28091613, 29308068, 31105696, 33081171, 37320880	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18075302, 20860602, 21614520, 29770329	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21847358	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22159401, 25176061, 26261495, 28984028, 31956659, 32493953, 37907568, 40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10669954, 11675683, 11720477, 11846206, 11875741, 12110091, 12115316, 12410931, 12657102, 12696078, 12890841, 16856880, 17100773, 17505508, 17605814, 18041056, 18212329, 18547492, 18626467, 18925694, 18928570, 19302703, 19551141, 19755989, 19801654, 20502715, 20665500, 20956472, 21057536, 21253009, 21655646, 22042086, 22573349, 22899991, 23219378, 23511629, 23780896, 23881929, 24119769, 24606948, 24633192, 24778130, 24786599, 24886512, 24938498, 24989926, 25488950, 25550804, 25778315, 26021863, 26044558, 26215891, 26228213, 26339385, 26400342, 26701102, 26984080, 27156071, 27407122, 27468719, 27583351, 27836247, 28338654, 28691643, 28754676, 28775934, 28975890, 29202733, 29463811, 29559845, 30206412, 30358217, 30385613, 30682039, 30972888, 31171735, 31268155, 31431792, 31485634, 31646819, 31950034, 32251007, 32384474, 32469992, 32620162, 33224312, 33416945, 33761933, 34319001, 34870494, 35562342, 35677048, 36014894, 36176934, 36901940, 37279009, 37964226, 38035560, 39473430, 7846687, 8855223, 9346879, 9751722, 9756852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15221993, 21637343, 29251173, 35266008, 8238242	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16014119, 28510571, 35732326	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15483346, 17965528, 19387481, 20036889, 20237991, 20349288, 22231433, 22355056, 23098453, 24165149, 25296855, 27413748, 27709850, 27729640, 28174788, 31658318, 33280526, 33888009, 34894606, 35769468, 8611409, 8755119, 9484827, 9605068, 9683299	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23166713, 33146672	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15517881, 23613251, 8238242, 9823778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12660426, 24902660		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29068435		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10901370, 11774259, 11804750, 11839574, 12114428, 12466143, 12529984, 12668280, 12684660, 12810677, 12874030, 14719060, 15047239, 15087251, 15213310, 15297183, 15897235, 16152587, 16886597, 16935322, 17010410, 17289129, 17289883, 17419711, 17498666, 17559911, 17717144, 18182107, 18337445, 19240722, 19253105, 19509553, 19765808, 19775995, 19782046, 20056267, 20130421, 20140681, 20195243, 20832104, 20973260, 21041183, 21236475, 21378364, 21782227, 22210436, 22411587, 22579791, 22700681, 23254909, 23652833, 24075030, 24141405, 24236050, 24761768, 24815691, 25092217, 25176450, 25296882, 25374251, 25577253, 25637316, 25835351, 26098087, 26158818, 26264619, 26531153, 26610586, 26909598, 27050277, 27064283, 27357817, 27401249, 27483433, 27498762, 27780361, 27852039, 27943222, 28008951, 28091613, 28116735, 28179359, 28289938, 28301874, 28383032, 28557832, 28574932, 28591727, 28952293, 29048687, 29069849, 29075785, 29218693, 29308068, 29416352, 29572186, 29721047, 29770329, 29845206, 29904943, 29962380, 30066848, 30093968, 30348916, 30444904, 30675307, 30929823, 31200683, 31639291, 7707437, 8261452, 9777956, 9815846		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	12448000, 26261495, 28916756, 29492715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	CTD_human_DG	17481528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	24075030		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	15581949		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	23933698	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	10732896, 16139132, 17297559, 37833902	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	11029398, 20607367		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17297559, 28399937, 37372424	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	20392463	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	22796508	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	12963640, 17297559, 26248134		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12963640, 17719840, 24229503, 26248134, 27903846, 28129792, 29695771, 29742506, 30439625		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10845866, 11728604, 12007735, 12499610, 12762479, 12907944, 15153644, 15212621, 15778409, 17229044, 17257729, 19715477, 21388351, 21737794, 21776026, 23545315, 24718046, 25169573, 26588727, 28306672, 28577233, 29376753, 29671205, 30061319, 30612603, 30644609, 30798839, 30860371, 31059085, 31285877, 31584518, 9839443		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	15964916, 24718046, 28765276, 35285386, 36005561, 36035865, 39201353, 39762845	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16608813		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	40247170	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	26881237	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	26881237		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21206178, 25893670	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	25893670		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	26174360	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	30125568		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11352239, 12507900, 16565972, 22241609	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	30597276		★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	28183278	Inhibit	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	27661663, 28345626, 28622063, 28904737, 30353107, 31656158		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	29258473, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	29191392		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28324102, 31144026		★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	30510170		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	35449729, 39364412	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	12918061, 29590109, 8380810		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	8380810	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	10772888		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	31156438		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	21706043, 32769962, 33891558, 35833818, 9342366	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	16121981, 16146767, 16412436, 16641198, 16784838, 17881973, 18534058, 19540294, 21757917, 23816753, 25270619, 27823555, 27909732, 27982773, 28060742, 28300551, 28823954, 29299743, 29395648, 29570780, 29842876, 30041898, 30536336, 31005253, 31085280, 31173308, 31418133, 31679265, 31728010		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28234972, 31173308, 36254030, 36426373	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	23592000		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	31039570	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	29257241		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	30382533		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10211994, 14726398, 15509618, 15573409, 16121981, 17061257, 17225860, 17587256, 17881973, 18534058, 19520980, 19540294, 21737794, 22158497, 23559636, 24797366, 26294080, 26981634, 27247852, 27462098, 27772541, 27984191, 28029607, 28267563, 28487988, 28645895, 28719819, 29198900, 29399074, 29525602, 29896433, 30092836, 30233326, 30431198, 30855407, 30882632, 30954486, 31038013, 31293107, 31312121, 31356182, 31555994		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	24055873, 29207094		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	24260517, 24786777, 34318873, 36479843, 37443201	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10448304, 12189553, 12821346, 15368588, 17505511, 17549406, 17678892, 19352388, 19566820, 19574782, 20797778, 21163514, 21222176, 21546870, 23193915, 23861821, 23873179, 23963849, 24297386, 24782650, 25061734, 25135429, 25541433, 25855930, 26067630, 26526574, 28177889, 28720059, 29247526, 29344192, 29654110, 29666026, 29928441, 30037277, 30338794, 30458457, 31035945, 31236742, 31452725, 31704874		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15790444, 15797633, 17549406, 19479977, 21543926, 26526574, 27812483, 29434970, 29654110, 31035945		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10448304, 12189553, 12821346, 15048132, 15368588, 15790444, 17549406, 17678892, 19352388, 19566820, 19574782, 20797778, 21163514, 21222176, 21546870, 23193915, 23861821, 23963849, 24297386, 24737201, 24782650, 25061734, 25135429, 25541433, 25855930, 26067630, 26526574, 28177889, 28720059, 29247526, 29344192, 29434970, 29654110, 29666026, 29928441, 30037277, 30338794, 30458457, 31035945, 31452725, 31704874		★☆☆☆☆ Found in Text Mining only
Cheilitis	Cheilitis	BEFREE	18641541		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11705851, 15014526, 16146532, 20510681, 22417860, 28550041, 30534565		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	20981743, 22664115, 29137304, 31404908		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19196819		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	21853101, 25147179		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20883786, 23082872, 25794107, 28302031, 31063715		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	28469969, 9669344		★☆☆☆☆ Found in Text Mining only
Chloasma	Melasma	BEFREE	29455565		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12615726, 18087285, 19291182, 19319137, 19663672, 21204912, 23608225, 24755544, 28212293, 28441383, 31110982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16465407, 18087285		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18087285, 18395502, 20636398, 21492330, 24935374, 26207380, 26762407, 30400838, 30920845, 35558087, 35901327, 37369494	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholecystitis	Cholecystitis	BEFREE	11584965		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	23057767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	LHGDN	12684689		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	36837507	Associate	★☆☆☆☆ Found in Text Mining only
Chondroma	Chordoma	Pubtator	21669154	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	15475194, 16324193, 16565972, 16949904, 23584483, 23686836, 25106798, 25150213, 25301739, 25444917, 25735814, 27826039, 28465477, 28704566, 29759564, 30605014, 31169001		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	15475194		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	15475194, 24901233, 25106798, 26013170, 32469486	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	16565972, 19509297	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	35974707	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	34127734	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12213878, 23267058, 25503134, 29223764, 7803624		★☆☆☆☆ Found in Text Mining only
Chorioretinal atrophy	Chorioretinal atrophy	BEFREE	29111834, 30872009		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	27989872		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	15148217, 21245410, 27783271, 30217183, 30498755, 33876574, 34158671, 36543599, 37598400	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	26915743, 32579694, 32799831, 34486473	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Disease	Chronic disease	Pubtator	17852434, 22737245, 9737465	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	11298785, 15880336, 20102314		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	18815217, 30995112		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	16046504, 16421229, 19060482, 20670331, 21080079, 22370607, 25410537, 27081865, 28542479, 29249229, 29915853		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	16421229, 18413200, 18434853, 18564903, 25410537, 27342693, 27367286, 27382979, 27927598, 28574576, 28601119, 28900259, 29055691, 29108104, 29442546, 29462869, 29654395, 29783932, 29804241, 30612603, 30732927, 31386888, 31542966, 31588798, 31635263		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	18413200		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	11880308, 17293375		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11050001, 11986954, 14996703, 17018398, 17287849, 18396013, 19336759, 19860625, 19965686, 20164467, 21519633, 21733558, 23335070, 23447383, 24971577, 25488616, 25966180, 26902783, 27861157		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	14749705, 15731179		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	12614929, 16583294, 24971768		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19466975, 27341002, 28554272		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12615615, 16355005, 16361360, 17044926, 17481912, 17631682, 17906365, 17968307, 18300052, 18818266, 19919523, 20801891, 21660298, 23656623, 26251585, 26926362, 27793775, 28117425, 28834088, 28865600, 28880936, 29872287, 30154415, 30542404, 30973786, 31090020		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17631682, 18300052		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	22028672		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23264219, 23592000, 26211001	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	23592000		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27091669		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	24574253, 26299569		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	22368191		★☆☆☆☆ Found in Text Mining only
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	BEFREE	25857959		★☆☆☆☆ Found in Text Mining only
Chuvash erythrocytosis	Chuvash Erythrocytosis	BEFREE	16769575		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11115828, 17244253, 19589268, 24057240, 24390792, 26782388, 31490422, 31790004		★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	20477965		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	27809226	Stimulate	★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	18041056, 23462807, 23881929, 26114873, 28410911, 28545581, 28549248, 30372389, 30478013		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	CTD_human_DG	25239121		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft Lip	Cleft lip	Pubtator	33947308	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	33947308	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28185961		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	31485183		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23182805, 25751166, 31791659, 34845413	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28193596, 28887194, 29248560, 31250275		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	25751166, 37686198	Associate	★☆☆☆☆ Found in Text Mining only
Cohen syndrome	Cohen Syndrome	BEFREE	15659795		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21098094, 21674706, 25797700, 29193791, 29518435, 30619283		★☆☆☆☆ Found in Text Mining only
Colitis Ischemic	Colitis	Pubtator	15770733	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12610101, 18159242, 29556626, 30892485	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25076849, 32022398, 35484353, 37078344	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10408390, 10457902, 10519388, 10690548, 10738243, 10760758, 10788475, 10987313, 11833093, 12209585, 12349828, 12374697, 12429975, 12810642, 14996738, 15289320, 15490972, 15883203, 16006751, 16127434, 16254106, 16543245, 16618894, 16773190, 17488804, 17695550, 17879399, 18365547, 18494554, 18505065, 18544566, 18613756, 18674879, 19292890, 19360289, 19492417, 19697322, 20532039, 20950431, 21091242, 21098094, 21468552, 21761115, 21766497, 21775090, 22509371, 22581265, 22992293, 23518595, 23536895, 23758730, 23794399, 24165321, 24213572, 24555920, 24780003, 25224594, 25371074, 25423914, 25740061, 26209639, 26379394, 27353863, 27887848, 28245709, 28245762, 28415573, 28445620, 28683891, 28738498, 28966326, 29079348, 29084916, 29282362, 29630948, 29709588, 29845255, 29894822, 29907957, 30639585, 31127996, 31348616, 31420015, 31717527, 7535799, 8757194, 8909524, 9422768, 9622060, 9731515		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	10547592, 17148604, 17369603, 19292890, 19436036, 23759331, 23794399, 25371074, 30941953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11956638, 12016145, 12727858, 16543245, 17695550, 18172321, 18172354, 18505065, 18613756, 19020709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	12003996, 12632503, 14669355, 18032824, 18414651, 19705030, 27513421, 36246978, 39527375	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	17785951	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	18987561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10760758, 11687953, 11727506, 11729113, 12209585, 12405290, 12673675, 12754739, 14754405, 14768007, 15026321, 15285012, 15498380, 15831913, 15908664, 15994743, 16006751, 16125170, 16143000, 16181451, 16299798, 16343055, 16397020, 16555551, 16600304, 16675573, 16685275, 16894565, 17531111, 17938959, 18158776, 18172253, 18392139, 18461364, 18583877, 18644977, 18830612, 19011936, 19148469, 19695243, 19876923, 19887045, 19904558, 19909248, 20015264, 20088793, 20143086, 20187681, 20395351, 20420953, 20514493, 20531372, 20594200, 20635170, 20857215, 21057529, 21378341, 21618508, 21632858, 21692070, 21725199, 21743435, 21766497, 22030865, 22058001, 22118052, 22171127, 22182247, 22199270, 22287745, 22385510, 22496856, 22670172, 22699782, 22751903, 23005896, 23118106, 23132736, 23167360, 23169005, 23169760, 23510802, 23579861, 23580238, 23820929, 23821017, 23838996, 23851494, 23900443, 23930204, 23970287, 23996743, 24025538, 24240588, 24260186, 24366689, 24370784, 24474253, 24495750, 24510238, 24573421, 24659637, 24727985, 24778007, 24780003, 24817953, 25076849, 25079441, 25117311, 25139485, 25224594, 25422250, 25423914, 25425971, 25561783, 25635747, 25955730, 26004415, 26031756, 26041938, 26065676, 26074693, 26107202, 26364891, 26370421, 26676225, 26676887, 26873137, 26896610, 26996193, 27033458, 27117754, 27128654, 27334288, 27421843, 27466499, 27494878, 27549777, 27735951, 27943279, 28055269, 28099146, 28106826, 28137239, 28141797, 28245709, 28255429, 28276498, 28298545, 28328959, 28330603, 28403223, 28415573, 28420432, 28422758, 28432289, 28528497, 28602978, 28714940, 28742793, 28757355, 28791360, 28870907, 28899659, 28900008, 29052437, 29097259, 29100316, 29100318, 29277790, 29285265, 29338550, 29357916, 29490990, 29532881, 29562227, 29675102, 29763380, 29845255, 29907957, 29917190, 29946728, 29953268, 29958090, 29983872, 30021192, 30037719, 30042763, 30118845, 30217479, 30228782, 30361904, 30423986, 30459123, 30499710, 30523755, 30584257, 30608431, 30636592, 30650178, 30694816, 30755600, 30834693, 30851425, 30862805, 30866992, 30972258, 31177854, 31278361, 31297348, 31300350, 31328737, 31394786, 31402291, 31409769, 31496821, 31594790, 31652600, 31662546, 31757048, 7535799, 8910616		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10408390, 11300331, 11376560, 11687953, 11733561, 11833093, 11857296, 11921018, 12046078, 12632503, 12800229, 12800231, 12853702, 12854171, 14521608, 14657950, 15235888, 15285012, 15457151, 15741766, 15754389, 15831913, 16202150, 16254106, 16258261, 16343055, 16543245, 16685275, 16741523, 16799477, 17016487, 17566019, 17695550, 17879399, 18032824, 18048970, 18320073, 18416455, 18505065, 18550579, 18583877, 18790786, 19014499, 19050802, 19192642, 19290007, 19574499, 20003271, 20187681, 20196786, 20205278, 20222950, 20305325, 20398057, 20459642, 20532039, 20565704, 20635443, 20940716, 20950431, 20953377, 21048041, 21507959, 21576240, 21669012, 21725199, 21743435, 21791631, 21892518, 21968416, 21980393, 22171127, 22182247, 22294255, 22321154, 22496856, 22670172, 22699782, 23086933, 23098501, 23148666, 23464465, 23536895, 23555666, 23651517, 23831629, 23861747, 24145180, 24180698, 24634093, 25076849, 25423914, 25741148, 25782664, 25817288, 25973082, 26031756, 26068766, 26074693, 26107202, 26107817, 26111775, 26259598, 26318037, 26320510, 26379394, 26402430, 26427914, 26615857, 26676225, 26676887, 26727921, 26873137, 26988990, 27002940, 27105577, 27117754, 27604859, 28129643, 28245709, 28328959, 28403223, 28415573, 28465540, 29845255, 29850390, 29917190, 30135139, 30228782, 30361904, 30397360, 30411783, 30476901, 30531836, 30834693, 30892441, 30941953, 30987352, 31250836, 31434836, 31646798, 31717527, 31752122, 31796117, 32022398, 32139668, 32248186, 32373955, 32434528, 32466535, 32539869, 32687588, 32700743, 32767322, 32867715, 33028695, 33324571, 33402467, 35208526, 35468741, 35595748, 35638907, 35810100, 36347835, 36422502, 36445057, 36656585, 37430251, 37790614, 38376276, 39173282, 39247989, 39513468, 8910616, 9528847, 9823983, 9888480	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11875709, 11921018, 12133521, 12174901, 12209585, 12800229, 15638384, 15665295, 16088182, 16675573, 17949784, 18048970, 18172253, 18461364, 18480385, 18583877, 19014499, 19141403, 19192642		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16006751, 18546269, 18613756, 29322789		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19540709, 24240588, 26730158, 28347226, 34092605, 34106269, 38096329	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29740162, 32552875	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	35638907	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	34146579	Stimulate	★☆☆☆☆ Found in Text Mining only
Complement Factor H Deficiency	Complement component deficiency	Pubtator	24084496	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	27081865		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	23086340		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	17673717, 19408988, 21316969, 21706043, 24509642, 24771337, 28339142, 29752992, 30414085, 30687014, 30975463, 31026826, 31805812, 8939195		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	LHGDN	18535271		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	19713864, 26510548, 28710035, 29251369		★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	20506964, 29258473		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	19342098		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24935374, 28814880, 30400838, 30881041		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	21671771, 27926976, 29638228, 31753611, 31824902		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	35711443	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	16569553, 17268888, 22735262		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	26073000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	15522743, 16569553, 19188426, 20140301, 24811984, 29444773, 30689460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital hemangioma	Congenital Hemangioma	BEFREE	18287964		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	29638228, 29879188		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of pulmonary artery	Congenital Hypoplasia Of Pulmonary Artery	BEFREE	14759416		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital hypothyroidism	Pubtator	32486504	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10865845, 11298785, 11404254, 15880336, 19332989, 20102314, 20139114, 23856679, 24321896, 25860916, 26338300, 26572862, 27133203, 29288927, 29353318, 30284587, 30513283, 31369643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	15732037, 15880336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conotruncal defect	Conotruncal defect	BEFREE	24443223		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contracture	Contracture	Pubtator	14554230, 19214689	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10211101, 10365146, 10475065, 11301389, 11846206, 11875741, 12115316, 12124351, 12597245, 12820432, 12853836, 14550470, 14744756, 15102658, 15448032, 15474339, 15534359, 15569051, 15611513, 15793222, 15964822, 16170373, 16204037, 16210641, 16507216, 16644575, 16804907, 16827904, 17158546, 17206887, 17255293, 17287073, 17340158, 17505508, 17616938, 18021253, 18041056, 18047741, 18095884, 18165617, 18212329, 18241003, 18391590, 18635227, 18925694, 18925847, 19470934, 19548138, 19601920, 19657325, 19755989, 20194016, 20437403, 20665500, 20673348, 20723915, 21253009, 21258414, 21330923, 21346035, 21491998, 21632885, 21882181, 21989163, 22125026, 22229848, 22613408, 22899991, 23073296, 23148638, 23219378, 23462807, 23497256, 23689123, 23867510, 23881929, 23972708, 24510280, 24593195, 24606948, 24610445, 24659637, 24767687, 24778130, 24943683, 24989926, 25062489, 25239121, 25379634, 25446042, 25538263, 25700976, 25778315, 25811348, 26021863, 26026587, 26044558, 26052049, 26114873, 26115098, 26214443, 26228213, 26304926, 26310563, 26400342, 26424759, 26465082, 26484606, 26509904, 26528707, 26597115, 26637866, 26647818, 26701102, 27030134, 27059553, 27407122, 27453294, 27468719, 27574806, 27623354, 27732931, 27738339, 27751729, 27836247, 27844272, 27918762, 27939075, 28039484, 28040423, 28062400, 28103578, 28107584, 28123542, 28161830, 28166200, 28185218, 28192155, 28221861, 28222071, 28247252, 28256615, 28276433, 28288043, 28330808, 28356760, 28489583, 28521439, 28545581, 28545998, 28562357, 28593813, 28624320, 28676023, 28691643, 28754676, 28756136, 28832978, 28890247, 28971328, 28974261, 28975890, 28978636, 29051029, 29079709, 29251173, 29297707, 29309249, 29323560, 29325434, 29463811, 29657088, 29707987, 29718721, 29728723, 29728867, 29784193, 29851529, 29854307, 29930727, 29942264, 30084668, 30122942, 30158285, 30158382, 30158581, 30195633, 30199151, 30206412, 30358217, 30372392, 30380460, 30478013, 30489037, 30513765, 30527746, 30572736, 30640790, 30687324, 30689402, 30726882, 30881919, 30924496, 30972888, 31156702, 31184937, 31194611, 31258725, 31268155, 31465470, 31477752, 31485634, 31496820, 31501271, 31532565, 31554440, 31646819, 31752390, 31810797, 7846687, 8589021, 9120987, 9756852		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	21998580, 30142821		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	11440623, 12122002, 15326102, 16500768, 17198016, 17692288, 19208899, 19482023, 19729595, 20450250, 21528000, 21850166, 22511848, 22659469, 23288987, 23423728, 24306423, 25090164, 27018842, 28233432, 28393322, 28584076, 28644870, 28740387, 28874077, 29246498, 29465315, 29888852, 30254425, 30355648, 30646013, 30782069, 30816491, 30984553, 31117124, 31772259, 31780873, 31795237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Neovascularization	Corneal neovascularization	Pubtator	19531249, 24866589, 26727921, 30948500, 9527324	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Neovascularization	Corneal Neovascularization	CTD_human_DG	9301478		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary aneurysm	Pubtator	32022379	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10426872, 10430759, 10430770, 10509970, 10865845, 10961959, 11133594, 11166270, 11195786, 11426585, 11717016, 11773594, 12582471, 12742981, 12762479, 14728030, 15331549, 15337699, 15347709, 15754021, 16627361, 16990600, 17707181, 17961532, 18373738, 19037583, 19307480, 19544222, 19565133, 19920796, 20116810, 20364398, 20489684, 20607367, 20621071, 21332365, 21573804, 22711306, 23137122, 23545315, 23639291, 23856679, 24865854, 25575606, 25755796, 26726843, 27704620, 27835972, 28364978, 28430629, 29478261, 29973139, 30035366, 30317903, 30786776, 31288177, 8756616, 9860779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	14668888, 15937083		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10430759, 10430770, 10509970, 10961959, 11133594, 11717016, 12228014, 12349828, 12742981, 12762479, 14668888, 14728030, 15347709, 15754021, 16627361, 17264508, 17707181, 17961532, 19037583, 19352324, 19544222, 19565133, 19920796, 20364398, 20489684, 20621071, 21252014, 21573804, 22116284, 22711306, 23137122, 23545315, 23639635, 23692382, 23856679, 23880405, 24247647, 24505095, 24865854, 25128838, 25575606, 25755796, 26726843, 26738788, 27704620, 27835972, 27994218, 27997860, 28364978, 28430629, 28888922, 29771429, 29973139, 30035366, 30317903, 31210329, 31288177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	14668888, 15937083		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	15754021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	17924284, 19920796, 23137122, 24505095, 24736319, 27704620, 27835972, 27994218, 28811677, 38003316, 39614436, 39684689	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	16139132	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	16151023, 17707181, 24736300, 25683698, 25755796, 26501555, 26726843, 27175642, 35866783, 40184077, 40247170	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10430759, 10430770, 10509970, 10961959, 11133594, 11717016, 12228014, 12742981, 12762479, 14728030, 15347709, 15754021, 16569553, 16627361, 17707181, 17961532, 19037583, 19352324, 19544222, 19565133, 19920796, 20364398, 20489684, 20621071, 21573804, 22711306, 23137122, 23545315, 23856679, 24443223, 24865854, 25575606, 25683698, 25755796, 26726843, 27175642, 27704620, 28364978, 28430629, 29205570, 29973139, 30035366, 30317903, 30689460, 31288177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	18261732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	24168783	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	28484288	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	10430770, 11717016		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	35866040, 39465738	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	11857307, 24934367, 29952957	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	24608455, 29952957		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24608455	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10102229, 16954806, 27270504, 27339637, 29415878		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12610101, 26867730	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18159242	Stimulate	★☆☆☆☆ Found in Text Mining only
Cruveilhier-Baumgarten Syndrome	Cruveilhier-Baumgarten Syndrome	CTD_human_DG	18416461		★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	19565133	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	18067639		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29755400		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	12058259, 15166498, 28756123, 28885396, 29755400, 30575644		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	10213212, 8667614, 9177415		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	LHGDN	18556049		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12349828, 17382901, 17481912, 23520314		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17382901	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21658316, 33387563, 34887365	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	18815217, 30995112		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	14641413	Stimulate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	21468552, 26600200		★☆☆☆☆ Found in Text Mining only
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	26930482		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16368150, 16816927, 17187682, 17393418, 18721452, 19103633, 19890996, 20495570, 21179282, 22124604, 22287106, 22609404, 22898216, 23274526, 23343469, 23500833, 24757145, 24939082, 25230745, 25274915, 25483913, 26090403, 27164955, 27989872, 28205383, 28620193, 29026147, 29258393, 29258882, 29327460, 29329496, 29488610, 29750304, 29843768, 30542428, 30597276, 30644305, 30734541, 31196179, 31280199, 31467907, 31662989, 31785770, 9228120		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	31709696		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	16583410, 25024308, 28032515, 29749552, 29933741, 31156438		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	LHGDN	16583410		★☆☆☆☆ Found in Text Mining only
Denys-Drash Syndrome	Denys-Drash Syndrome	BEFREE	17267748, 17487399, 19909248, 23076130, 29462869		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19423950, 19571140, 23164459, 23673188, 24636631, 24718046, 26556286, 27527872, 28267147, 29574217, 29731825, 29968119, 31103810, 31830487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	22832727, 27527872	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23623252, 23673188, 24636631, 24718046, 25474224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	24718046, 25683698	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	24718046	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	20795427	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	20795427	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22413008, 26124183	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24032555, 28821884	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	7738351	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16456664, 22413008, 24033157, 30132823		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16456664		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	10546564, 16630077, 23166713, 28349651, 31492195, 31545526		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	18821695		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	18821695, 30142763	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	29216907, 30142763, 30657097		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29545927		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12677400, 14988276, 15042541, 15544519, 16731852, 16901919, 17545302, 17961532, 18441306, 18607348, 18647955, 18682813, 18926584, 19272614, 19666581, 20127137, 20444917, 20501654, 20547975, 20565248, 20566749, 21139695, 21357793, 21362767, 22003113, 22658411, 22879915, 23093658, 23150625, 23448535, 24093675, 24198286, 24399295, 25572464, 25818803, 25884496, 26054568, 26459282, 27848046, 27921359, 27984191, 27988882, 28116460, 28285015, 28542479, 28601428, 28662688, 29108104, 29118015, 29164711, 29169872, 29290003, 29427700, 29435181, 29487115, 29944850, 30032215, 30054234, 30401898, 30407281, 30579324, 30654317, 30719863, 31075259, 31396410, 31449822, 31506830, 31792234, 9245719		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35757473	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Gestational	Gestational diabetes	Pubtator	20674013, 27606810, 30350881, 31099333	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27645229	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34930438	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11110694, 12631341, 15923499, 16139132, 16541023, 19145248, 19539633, 20570185, 20801867, 23106921, 26044558, 26156593, 27175642, 27783271, 30579324, 32680978, 32875492, 33369638, 33515594, 35069435, 35285425, 36360783, 37365645, 37443201, 40016689	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12677400, 14988276, 15042541, 15544519, 16731852, 16776576, 16778129, 16901919, 17545302, 17961532, 18441306, 18607348, 18647955, 18682813, 18926584, 19272614, 19404486, 19666581, 20127137, 20444917, 20501654, 20547975, 20565248, 20566749, 21139695, 21357793, 21362767, 21782920, 22003113, 22658411, 22879915, 23093658, 23150625, 23448535, 24093675, 24198286, 24399295, 25572464, 25818803, 25884496, 26054568, 26459282, 27836326, 27848046, 27921359, 27939902, 27984191, 27988882, 28000874, 28060742, 28116460, 28285015, 28364978, 28431433, 28542479, 28587414, 28601428, 28662688, 28836407, 29074590, 29108104, 29118015, 29164711, 29164834, 29169872, 29249229, 29290003, 29364466, 29427700, 29435181, 29487115, 29642210, 29804263, 29944850, 29972827, 29977804, 30032215, 30054234, 30279491, 30401898, 30407281, 30477146, 30579324, 30654317, 30719863, 30729134, 31075259, 31079353, 31294138, 31396410, 31437234, 31449822, 31506830, 31737629, 31792234, 9245719		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	14554230, 18385799, 19577077, 23303012, 23421785, 34944529	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16778129, 31676796	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	17716775, 18078864		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24523574, 25179090, 37468555	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39273664	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16139132, 21084393, 22064697, 22162628, 23405237, 24505095, 25587982, 26881237, 27325467, 28662688, 28761062, 30719863, 30787295, 32851081, 33942489, 34560403, 34675276, 37047308, 38027164, 39273385, 39766291	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23935253, 33906524	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34944529	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12505748, 16508738, 17513698, 17616354, 19263526, 25179090, 26768002, 28324102, 28421206, 28637396, 29850590, 31632589		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11978667, 15191350, 17121786, 17259494, 17264508, 18709380, 19455301, 20127137, 20591524, 20927120, 21562766, 21757152, 22162628, 22377712, 22437209, 23213275, 23353010, 23405237, 24534217, 24623964, 24751925, 24812430, 25128838, 25159845, 25587982, 26130419, 26881237, 27062013, 27325467, 28149790, 28401323, 28444660, 28465347, 28761062, 29055125, 29201234, 29228585, 29435181, 29533820, 29642210, 29721017, 29768333, 29901584, 30032215, 30061319, 30233664, 30377797, 30389746, 30579324, 30588418, 30597763, 30630371, 30652413, 30654317, 30708140, 30787295, 30873661, 31422516, 31437234, 31473834, 31499478		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	16151023, 22064697, 29582815	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	22064697, 25128838, 30654317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30511620		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	33909697, 34926700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	29768333, 29901584, 35909542, 36232122, 37365645	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	10674029, 11499563, 11912219, 15610240, 16541023, 21752957, 26156684, 28990106, 31277135, 33274236, 35069435, 37038746, 37415174, 37861555, 39273385	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17264876, 35637650	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10674029, 11499563, 11912219, 12505748, 12872442, 14988276, 15031673, 15191350, 15610240, 15685506, 16394111, 17121786, 17475821, 17545302, 17616354, 18607348, 18926584, 19796028, 20015944, 20501654, 20522599, 20565248, 21228103, 21752957, 21868397, 23405237, 25280384, 26768002, 27598902, 27836681, 28648975, 28667418, 29249229, 30389746, 30515388, 30865689, 31028725, 31447680, 31568645		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	12505748, 14610338, 15610240, 17475821, 17616354, 18842317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	18630688		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	10218880, 11529248, 16610979, 20352346, 21596454, 27836326, 31499478		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	18250616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	19399887, 40214234	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	19399887, 26130419		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	10435836, 10469350, 10494799, 10845581, 11499563, 11978667, 12597922, 14566975, 15191350, 15277220, 15294883, 15544519, 16193288, 16398617, 16636650, 16735996, 16901919, 17121786, 17445799, 17470563, 17548166, 17658465, 17698375, 17849138, 18363167, 18441306, 18497878, 18709380, 19145248, 19263526, 19404486, 19553626, 19628492, 19796028, 19909248, 20444917, 20547975, 20591524, 20801867, 21357793, 21757152, 21779563, 21801028, 22162628, 23076130, 23353010, 24018047, 24131746, 24138043, 24138044, 24376787, 24502825, 24534217, 24623964, 24741610, 24751925, 24868559, 25217793, 25457617, 25562624, 25884496, 25956512, 26015772, 26054568, 26125742, 26400610, 26553067, 26617758, 26720478, 26942449, 27059477, 27207524, 27421659, 27613596, 27648002, 27886182, 27909871, 27913654, 27991577, 28122089, 28122882, 28249594, 28299499, 28341661, 28374767, 28376510, 28452992, 28503421, 28601428, 28680264, 28724746, 28767589, 28931763, 28964802, 28969616, 29030794, 29055125, 29076766, 29137019, 29146180, 29150277, 29172741, 29203232, 29259905, 29280940, 29285153, 29392528, 29487115, 29497837, 29575757, 29584759, 29621508, 29721978, 29724654, 29802904, 29846863, 29944850, 30007476, 30178824, 30186476, 30353220, 30485520, 30551523, 30588418, 30654317, 30662833, 30664126, 30835139, 30878488, 30980286, 30987058, 30999027, 31019585, 31055948, 31173913, 31270273, 31364104, 31383483, 31396410, 31436780, 31437234, 31473834, 31496691, 31557880, 31653890, 31669065, 31689123, 31715608, 31759996, 31787868, 31848562, 9245719, 9502762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	11499563, 14747470, 15923499, 16202216, 16636650, 17698375, 19145248, 19531249, 20801867, 22064697, 22162628, 23144758, 23405237, 24623964, 25352747, 26617758, 26957843, 27648002, 27771716, 27783271, 28680264, 29392528, 29584759, 30007476, 32590003, 32836220, 33683746, 33709000, 34010297, 34542556, 35069435, 35590353, 37053203, 37820680, 37856104, 38194422, 39260060, 39348384, 9539788, 9753694	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	CTD_human_DG	11978667, 15788408, 20577866		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	12453985, 15963467, 16202216, 16514669, 16636650, 17121786, 17470563, 17622743, 17716775, 17849138, 18363167, 18441306, 18682813		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	20801867, 23106921, 26325091, 29582815, 33328159, 35285425	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	20940716	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28183278	Inhibit	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	21316013	Stimulate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	39412903, 39873996	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	10194527, 18596272, 24628546, 25560732, 27849428, 28817373, 29464101, 31186313, 9360534		★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	27325687, 28818988		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22129133, 22882209, 23020605, 28326867, 31097785		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	12597922, 16735996, 21309690, 23076130, 24021586, 24863063, 27913654, 29398697, 30406651, 31256417, 31399890, 31450226, 9212726		★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	29108393		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	28514870		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	38319150	Associate	★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	LHGDN	16911686		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	15358155		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23040494, 26513650		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23040494, 33260695	Associate	★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	16452172, 28114590		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	31927552	Stimulate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	7821921		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	12607595, 16538528		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	7821921		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	19496079		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	23992143	Associate	★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	BEFREE	28957003		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	21771855		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28189572		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	28147322		★☆☆☆☆ Found in Text Mining only
Dystonia, Dopa-Responsive, due to Sepiapterin Reductase Deficiency	Dopa-responsive dystonia	BEFREE	28153505		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	26130419, 31499478		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	25384022		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	14997002, 16517614, 18469803, 19529993, 19909248, 20666936, 22596155, 23957473, 25322977, 25341970, 26940670, 28109704, 29436641, 29455633, 31455120		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	17543095	Associate	★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	BEFREE	31704874		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16456664, 22413008, 24033157, 30132823		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	10704059, 12521215, 16609965, 18796682, 21481277, 21968684, 23818357, 24459428, 25337261, 25878490, 26585263, 31039570, 39533623, 7615975	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	24067772	Stimulate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	16077930		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	15802335, 18202163	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	19129286, 22850689	Inhibit	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29170534		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	18854444, 27887787, 31068089		★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	30605014		★☆☆☆☆ Found in Text Mining only
Enchondromatosis	Enchondromatosis	BEFREE	28957003		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	27501129		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	10585594, 11232025, 12568850, 12759248, 16140938, 22170435		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10381125, 10468067, 10816575, 11232025, 11957147, 12782015, 12942123, 12971625, 15581949, 15860258, 15917160, 16267616, 17630849, 19148513, 19819950, 20127022, 21363919, 22057922, 22170435, 22178239, 22711307, 22904162, 23176363, 23985752, 24845798, 25231075, 25981814, 27770434, 28969913, 28991928, 29024813, 29033580, 29133593, 29155953, 29404887, 29461590, 29920344, 30488858, 30863089, 31587503, 31677820, 31701462, 8481475, 8626126, 8697391, 9032563, 9458078		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	17380299		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	17442020, 19249761, 26429165, 9032563	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10816575, 11710596, 12568850, 12711006, 12942123, 16140938, 16357517, 16557278, 18644593, 19779103, 21103625, 21228924, 22170435, 22640183, 23334331, 24420153, 24918449, 25019571, 25487944, 29461590, 30488858, 31322068, 31587503, 35242299, 35546509, 36479043, 9032563	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	11957147, 18094433, 19148513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	17380299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17442020	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	30488858, 31587503, 9032563		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	BEFREE	15668894, 21335415, 24608518		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10559660, 10634417, 11532483, 11730754, 12095505, 12372470, 15242995, 15668894, 15746194, 15979997, 15986219, 17482599, 17963063, 17977866, 18650217, 18930211, 19001553, 19189995, 19416175, 19524222, 19531502, 20041256, 20137818, 20555002, 20561612, 20574053, 21055747, 21335415, 22128802, 22230112, 22392487, 22477338, 22975116, 23061744, 23613250, 23952049, 24133580, 24155090, 24608518, 25255852, 25573961, 25984730, 26577912, 26773192, 27009232, 27453397, 27695098, 27744455, 27807692, 28397725, 28990049, 29017687, 29285116, 30074218, 30119243, 30254304, 30431056, 30443175, 30447298, 30608887, 30662514, 31012030, 31065021, 31147011, 31701462		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11594532, 12095505, 12372470, 17482599, 17765237, 17963063, 18644593, 18930211, 22128802, 24133591, 25255852, 26773192, 27323121, 27608888, 27807692, 27939762, 31234682, 32311852, 32515360, 32619126, 33723310, 35459174, 36232341, 36672827, 8755660	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12594002, 15668894, 15746194, 15979997, 16322068, 16962110, 17602688, 17765237, 17963063, 17977866, 18053993, 18556049		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19324337, 21614520, 26577912, 28397725, 34342087, 34920657	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	17353160		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	LHGDN	17353160		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	17353160	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31383782, 37272765	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	20367336, 26369495, 29354850, 31308481, 9669344		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	29967610		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	22812626	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28193596, 29509306, 30414085, 31297012		★☆☆☆☆ Found in Text Mining only
Epilepsy, Benign Psychomotor, Childhood	Epilepsy	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Epilepsy, Lateral Temporal	Epilepsy	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	CTD_human_DG	17533168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epiretinal Membrane	Epiretinal Membrane	BEFREE	20220056, 23296045, 23438977, 27229756, 28878218, 29190236, 30380554		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	30523303		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15047239, 15087251, 15297183, 16152587, 16935322, 19240722, 19509553, 19765808, 19782046, 20056267, 20140681, 20195243, 20832104, 20973260, 21236475, 21378364, 21782227, 22411587, 25092217, 26909598, 27357817, 27780361, 28091613, 28116735, 28383032, 28557832, 28574932, 28591727, 28952293, 29308068, 29416352, 29572186, 29770329, 29845206, 29962380, 30444904, 30675307, 30929823, 31200683, 8261452, 9815846		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	12812318, 16843105, 23019156		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11774259, 12432284, 15087251, 17374999, 28509606, 30699437, 9426398		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	30563806		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	CTD_human_DG	12002441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erectile dysfunction	Erectile Dysfunction	BEFREE	23007311, 28364978, 29486902, 30477146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erysipelas	Erysipelas	BEFREE	28512644		★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	27376564, 28811677, 7738351		★☆☆☆☆ Found in Text Mining only
Esophageal and Gastric Varices	Esophageal And Gastric Varices	LHGDN	15754412		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	27372649		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal atresia	Pubtator	33121738	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal atresia with or without tracheoesophageal fistula	Tracheoesophageal fistula	BEFREE	27372649		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10457902, 12119553, 12239588, 17511025, 18837095, 19366059, 19584152, 20181455, 22994764, 23206445, 23838139, 24206575, 24284961, 24654773, 25640399, 27340350, 28435293, 28536606, 29805549, 31096474, 31289557, 31824776, 9635853, 9683819		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10457902, 12119553, 12239588, 17511025, 18837095, 19366059, 19584152, 20181455, 22994764, 23838139, 24206575, 24284961, 24654773, 25640399, 27340350, 28435293, 28536606, 29805549, 31289557, 31824776, 9683819		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	11961303, 12854174, 18837095, 19136271, 19584152, 22994764, 24284961, 25169488, 25640399, 31102307, 31858546, 34157252, 8755119	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12239588		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24803825	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18023103, 18439605, 21468258, 22134872, 22627741, 23155356, 24945674, 25172294, 25624724, 26323923, 31556558, 32474512, 32662828, 34315926, 35463992, 37752569, 38055382, 9635853	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26099724	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	22849380		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	15867486	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	35564692	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	20179634, 20621078, 22209952, 28350619, 28402508		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25945941	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	14707272, 14710346, 14977835, 15814647, 16557578, 18537159, 19642105, 20066901, 31169001		★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	27510449, 29489039		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18087285, 23721191		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	16940309, 19896188, 20019880, 20847577, 21158586, 21309690, 21558292, 21744122, 21801028, 21830945, 22594510, 23112570, 23149126, 23570466, 23582991, 23745581, 24070809, 24157918, 24303777, 25457617, 25494018, 25635578, 26426212, 26974308, 27064391, 27404493, 27429385, 27449314, 27617537, 27627752, 27768790, 27832661, 27840917, 27874278, 27929753, 28079756, 28100839, 28107458, 28114590, 28114653, 28221254, 28231837, 28236576, 28301850, 28400373, 28489692, 28526489, 28601428, 28654629, 28656102, 28726562, 28756707, 28820850, 28866675, 28926190, 28926193, 28926292, 28950272, 28993010, 29020433, 29074495, 29164480, 29177891, 29292162, 29305324, 29324593, 29390407, 29704861, 29734180, 29768266, 29800991, 29843663, 30001546, 30002400, 30030393, 30077616, 30149035, 30156152, 30161096, 30177632, 30200369, 30412448, 30425852, 30529685, 30534004, 30589663, 30679743, 30788433, 30797883, 30825671, 30834517, 30842468, 30844038, 30851267, 30901385, 30986442, 30999772, 31055948, 31088111, 31282617, 31294771, 31367847, 31550048, 31558491, 31589766, 31606444, 31613840, 31792234, 31843790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
exudative macular degeneration	Exudative macular degeneration	BEFREE	20887885, 29111834		★☆☆☆☆ Found in Text Mining only
Exudative retinopathy	Exudative retinopathy	BEFREE	23221067, 28424147, 30414256, 30895419		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	27768202	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	32184103	Stimulate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	23332617, 30282881		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Familial cerebral cavernous malformation	Cerebral cavernous malformation	Pubtator	32556941	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial Exudative Vitreoretinopathy	Exudative Vitreoretinopathy	BEFREE	18317351		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	11074523, 25356681		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	10200298		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22258871, 28985034, 31514445		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	27188753	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24520215		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	22658783, 28110063		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	27903846		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	12215337, 18256925		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	18256925, 21056306, 26884457, 27748285, 28010141		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	22034877		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10048976, 12085210, 12086892, 15994966, 16230387, 17727254, 25937533, 28377452, 31173185		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	LHGDN	12062186		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	11981751		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12677092, 15605080, 28118605, 28440736, 28472595, 28744285, 30394698, 30864692, 31534314		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29162878		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	18317782	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	21978756, 29137483, 30340546, 31699213		★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	30340546		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12193566, 14605010, 16260429		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	27265443, 28719137		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	20413880		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	18729809, 21311163		★☆☆☆☆ Found in Text Mining only
FUNDUS DYSTROPHY, PSEUDOINFLAMMATORY, OF SORSBY	FUNDUS DYSTROPHY, PSEUDOINFLAMMATORY, OF SORSBY	BEFREE	25766588		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	11584965, 16489641, 18676870, 23653380, 23962084, 24185122, 25154789, 28212293, 30272364, 31002375, 31110982		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	15309734, 15968728, 16489641, 18676870, 21853312, 25632198	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	38554345	Stimulate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	20662003		★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	9845647		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15682485		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	11353854		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	LHGDN	15246970, 15838334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	BEFREE	15638736, 15838334, 19120886, 19496079, 9177300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	BEFREE	23030255		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	11978184	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	21249411		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	26805636		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26151457, 35564692	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	24357184		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	26194361	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	20593045, 25839219	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	16954806		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	14669355		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	14669355, 21330783, 28594907	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16521182, 17299397, 17334345, 18006774, 19860642, 21817899, 22489693, 23408993, 23551429, 24124608, 27777285, 29054076		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	16521182, 17036392, 17299397, 21977985, 22439647, 23408993, 24124608, 25987131, 26078569, 26576593	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	18006774		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	27836528		★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	BEFREE	12960698		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	28003009, 28236576, 30690195		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	25085632, 8760299		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	14528511, 16142870		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	16142870		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	21989653, 34204585, 35349405	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16356833		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	12850503, 18283716, 30675196		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	25929323, 35695550	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	20127137		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	25861162	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	29149180	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	19474408, 21907194, 28168047, 28358961, 30210601, 30472176, 31274018		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	32043817	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33746571	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	26748993	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	36254076	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987, 32043817	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28622063, 30473883		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10050881, 10215998, 10336429, 10416597, 10571418, 10778727, 10885623, 11059786, 11303624, 11358846, 11741977, 12445161, 12517803, 12622137, 12702589, 1279431, 12918061, 14695215, 15015778, 15084786, 15313899, 15453096, 15688401, 15949234, 16150649, 16175187, 16244591, 16340308, 16518831, 16580881, 16622457, 16682012, 16804907, 17122647, 17273768, 17524506, 17574778, 17611713, 17906459, 18523971, 18974115, 19291283, 19349600, 19567589, 19618119, 19809523, 20367336, 20446891, 20501615, 20671264, 20838435, 20883786, 21191630, 21204766, 21385870, 21458987, 21480238, 21775090, 22085359, 22415301, 22472177, 22492960, 22673390, 22786655, 22884072, 23132729, 23204518, 23403631, 23838182, 23970099, 24129546, 24465898, 25039617, 25129238, 25213694, 25348671, 25488073, 25665548, 25676691, 25680186, 25682871, 25963717, 26090865, 26339347, 26373393, 26762204, 26951556, 27345398, 27472259, 27787897, 27853960, 27882487, 27942839, 28138554, 28169441, 28202289, 28287096, 28386777, 28410224, 28555422, 28655794, 28668888, 28780387, 28797294, 28879167, 28912141, 28948650, 28963609, 28969371, 28973887, 28982661, 28994107, 29030990, 29152068, 29239327, 29262591, 29262608, 29507055, 29573206, 29574193, 29584591, 29603739, 29644004, 29754163, 29782366, 29909500, 29950856, 30065025, 30144594, 30165233, 30176167, 30327956, 30368528, 30414187, 30480778, 30680510, 30718358, 30736462, 30769863, 31035344, 31040671, 31043429, 31098995, 31106423, 31199673, 31554364, 31597643, 31660979, 31665239, 31698752, 31713115, 31723000, 31788092, 8246443, 8710899, 8833917, 9242380, 9255258, 9342366, 9370235, 9592205, 9600216, 9669344, 9787178, 9811337		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	10336429, 10864205, 11741977, 11912213, 12445161, 12918061, 12937144, 15973775, 16175187, 17075581, 17132220, 18796682, 18804099, 19291283, 19349600, 19574499, 20462964, 20671264, 21179202, 21191630, 21199795, 21242296, 21481277, 22311740, 22497886, 22591734, 23833308, 24008569, 25010988, 25165192, 25337261, 25501707, 26090865, 26472724, 26585263, 26627848, 27705944, 28410224, 28797294, 28837676, 29110584, 29584591, 30165850, 30176167, 30353265, 31043429, 31554364, 31698752, 31983122, 31991805, 32164575, 32647207, 33471197, 33803224, 35173528, 35328072, 35606527, 35813230, 36043525, 36435833, 36647156, 36853018, 36968223, 37948373, 39709472, 40227555, 9342366, 9811337	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	11741977, 11912213, 12445161, 12918061, 15453096, 17618600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	16356833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	20458050, 23787764, 32074192, 33199490, 33807899, 35392912, 38036978, 39196480	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	10050881, 10077162, 10336429, 10571418, 10885623, 11059786, 11358846, 11741977, 11756757, 11778649, 12234411, 12517803, 12622137, 12702589, 1279431, 14695215, 15015778, 15084786, 15313899, 15453096, 15674480, 15688401, 15949234, 16150649, 16175187, 16244591, 16340308, 16518831, 16580881, 16622457, 16682012, 16804907, 17122647, 17273768, 17524506, 17574778, 17611713, 17671724, 17906459, 18523971, 18974115, 19349600, 19567589, 19618119, 19732454, 20446891, 20501615, 20671264, 20838435, 20883786, 21191630, 21204766, 21385870, 21458987, 21480238, 21775090, 21900396, 22085359, 22393126, 22415301, 22492960, 22673390, 22786655, 22884072, 23132729, 23204518, 23403631, 23787764, 23838182, 23970099, 24129546, 24465898, 25039617, 25129238, 25213694, 25348671, 25501993, 25676691, 25680186, 25682871, 25963717, 26090865, 26339347, 26373393, 26514451, 26762204, 26951556, 27345398, 27472259, 27787897, 27853960, 27882487, 27897101, 27942839, 28169441, 28202289, 28287096, 28386777, 28410224, 28555422, 28655794, 28668888, 28780387, 28797294, 28879167, 28912141, 28948650, 28963609, 28969371, 28973887, 28982661, 28994107, 29030990, 29152068, 29239327, 29262591, 29507055, 29574193, 29584591, 29603739, 29644004, 29754163, 29782366, 29909500, 29950856, 30065025, 30144594, 30165233, 30176167, 30327956, 30368528, 30414187, 30680510, 30718358, 30736462, 30769863, 30971896, 31035344, 31040671, 31043429, 31098995, 31106423, 31199673, 31554364, 31597643, 31660979, 31665239, 31698752, 31713115, 31723000, 31788092, 8246443, 8380810, 8710899, 8833917, 9242380, 9255258, 9342366, 9592205, 9600216, 9669344		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16356833		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10215998, 10448307, 10571418, 10682677, 11245272, 11741977, 11751496, 11809713, 12702589, 14980508, 15160992, 15700836, 15701277, 15967572, 16247462, 16357523, 16518831, 16612574, 16951188, 17704802, 17881084, 18937073, 19192961, 19431143, 19618119, 20209496, 20446891, 20702765, 21116837, 21117958, 21220497, 21394106, 21517260, 21618540, 21900396, 22159356, 22199315, 22356893, 22393126, 22711017, 22834685, 23011120, 23229761, 23242200, 24008569, 24374745, 24627040, 24781871, 24893038, 25175315, 25758142, 25879429, 26084601, 26093379, 26356851, 26362401, 26449498, 26645582, 26894862, 26909925, 27050958, 27352347, 27601165, 27926485, 28218903, 28443475, 28591697, 28594935, 28602979, 28812437, 28901424, 28943909, 28948650, 29137376, 29218099, 29330968, 29357089, 29366307, 29584591, 29745085, 29941486, 30062604, 30066885, 30107336, 30136881, 30429891, 30652410, 30791546, 30845704, 31280210, 31400609, 31624989, 31631037, 31639060, 31653130, 7525492, 7532545, 8586468, 8910439, 9592205, 9669344, 9872603		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10389985, 10682677, 10864205, 11324417, 15814920, 16042757, 16212813, 16357523, 16900782, 17075581, 17611402, 18781179, 19671762, 20838435, 21517260, 22159356, 22356893, 22906272, 23525947, 24008569, 24922514, 25165192, 25674231, 25758142, 25823012, 26449498, 26620922, 26894862, 26909925, 27926485, 28410224, 28901452, 28990104, 29584591, 31414734, 31486713, 31639060, 31983122, 32074192, 33545987, 33765507, 33786635, 33962397, 34815366, 35581384, 35857445, 39364412, 40621799, 7856749, 8774132, 8910439	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11809713, 16084492, 16612574, 16773219, 17881084		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26473373	Stimulate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	10050881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
gliosarcoma	Gliosarcoma	CTD_human_DG	16533777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	BEFREE	30134834		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11485918, 12872442, 17994443, 20545903, 21978756, 24673399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	17994443, 24577260, 24673399	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	16526314, 29137483	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	25875837	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	31316523		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	17726104, 17994443, 19475536, 20375117, 21978756, 28130181, 8738799		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	21372519, 21978756	Associate	★☆☆☆☆ Found in Text Mining only
Glomus Jugulare Tumor	Glomus Jugulare Tumor	BEFREE	20030694		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	18708255, 19800536, 19896188, 20019880, 20847577, 21158586, 21282580, 21744122, 21830945, 22521084, 23971975, 24080590, 24157918, 24365177, 25457617, 25558172, 26974308, 27069359, 27404493, 27840917, 28107458, 28151839, 28236576, 28679845, 28866675, 28887057, 28926193, 29193961, 29197628, 29211782, 29367644, 29446046, 29734810, 29864423, 29902977, 30082848, 30103950, 30157273, 30534004, 30594908, 30825671, 30842468, 30844038, 30851267, 31055948, 31173913, 31294771, 31317354, 31633290, 31644596, 31768932		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	21245410	Inhibit	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	22848690, 32106291, 35326447	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	16518330	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19041064	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19041064	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	19041064		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-Positive, Type II	Granulomatous Disease	BEFREE	26425083		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	LHGDN	18394773		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	21041381		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11172289, 22771446, 24080368, 27494076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	17696908, 27494076, 32074519, 35008579	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	18797655, 27423310, 35008579	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	10780661, 33541438	Associate	★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	19664288		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	26476432		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	30310054		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	15261137		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	25944736		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27494076		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	27494076, 32074519, 32615729, 33916948	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10897108, 11078794, 11326316, 15155138, 15330158, 16641910, 19082496, 19663672, 20098841, 20204302, 21480395, 22987573, 24057180, 30804145		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	11326316, 15330158, 15475932, 16641910, 20098841, 20237991, 21480395, 26171937, 35806488, 38376273	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	16499871		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	16499871		★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	32718338	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	16127192	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	24811984, 27450023, 33260695, 34313777	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	16844662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart Diseases	BEFREE	17610292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	33260695, 34887365, 36598310, 39201353	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	10865845, 11298785, 19332989, 20139114, 23856679, 24321896, 25860916, 26338300, 26572862, 27133203, 29288927, 30284587, 31369643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	15732037, 15880336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	15951350, 23155356, 28790053, 29784904, 32839603, 34724901, 40247170	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	15732037, 15880336		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	33757570, 35870951, 36759823	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	18167313, 28338787		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	11114720, 11310918, 15611513, 17070589, 17218907, 24138046, 25310734, 26920352, 27388534, 28710479, 29805741, 30497198, 31242765, 31694494, 7533661, 7688226, 8380810, 8627342, 8930647, 9370235, 9787178		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	10024670, 11733376, 12644949, 16200077, 18287964, 20237346, 20393000, 22900063, 23357661, 24704994, 28186692, 28339093, 29042972, 29192323, 29327758, 29469063, 29490757, 29512710, 29790692, 30070315, 30214550, 30323877, 30342949, 30562741, 31242765, 9915157		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	20872175, 29664206, 30070315, 32091151	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	11480589, 19723655, 22532251, 27160228, 28078663, 29623256, 31004117, 31305298, 31510873, 8558848, 9811333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	Pubtator	15015593, 31004117, 31510873, 32912994, 8644848, 9811333	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	17569031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11274014, 12094254, 15205354, 15471951, 18987662, 19707156, 24183807, 29200164		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	11768614, 29137304		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	19779281	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	21409457, 24067772	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	36899322	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	26318037	Associate	★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	27910891	Stimulate	★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	29262646, 30293229		★☆☆☆☆ Found in Text Mining only
Hemiplegia	Hemiplegia	Pubtator	36820574	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	23287320	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemoglobin C Disease	Hemoglobin C Disease	BEFREE	18080800		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	12475675, 29061162		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	29061162	Associate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	11943725	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	30041762	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33641611	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	29436669		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	19201650, 21206178, 21706043, 23594677, 27503021, 31039570, 31217347, 33211216	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	31293107	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	39969331	Stimulate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	16395752, 23325094, 28691415		★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	21330458, 26790967	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23485556, 27861157	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	16627984, 19944696, 34644732	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	20483710	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	29055924	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	23091809	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12851730, 16857775, 24330582, 27362796		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	32146800, 34978260	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26631613		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19574499, 21390493, 25448984, 30394935, 31752829, 32393308	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	27725196, 30066918		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	29365079		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	LHGDN	15583822		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	15754019, 18949376, 26608985, 28224235, 30329172, 31681913		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	26951238		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	19144048, 22508396, 29366758		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12210089, 29456507		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	15120936, 18950958		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24141626, 24489836	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23799534, 25915065, 29456507, 31614758		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25915065	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	32074519	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	9120987		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	23522390, 27885689		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole, Partial	Hydatidiform Mole	BEFREE	23522390		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	23522390, 27885689		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	25951999		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	23626817	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17852837, 23429999, 25433555, 30642356		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	31049005		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10218880, 17545302, 18670619, 20547975, 21782920, 22879915, 25222223, 25401697, 26861446, 27606810, 27645229, 28341661, 28431433, 28680264, 29076766, 29203232, 29307595, 29351188, 29435181, 29615543, 29774557, 29804263, 29890158, 30361814, 30478742, 30551523, 30980286, 31120617, 31270273, 31374233, 31487015		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	20674013, 25401697, 28680264	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27606810, 39329718	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28840773, 29582815, 33065984, 33328159, 33709000	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	LHGDN	12957716		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	25108133		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11804995, 22581719, 27325467, 27435064, 31412315		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	23559636, 24718046, 28143622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperoxia	Hyperoxia	Pubtator	19734318, 29334947	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	33215223, 33632168	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	10337031, 11380837, 18459027, 19623180, 8644848	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	17452774	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	20052595	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18824714, 21882181, 24786777, 24959596, 25047123, 26044558, 26400342, 27175642, 27367286, 32175644, 33541438, 33652665, 34775477, 34797313, 35075138, 35365727	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	33760199	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	39595551	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	10212108, 28514291, 31703702, 36483920	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Renal	Renal hypertension	Pubtator	27367286	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10886723, 11590837, 16769575, 17044926, 17467022, 17601412, 17726104, 17906365, 18534058, 18824714, 19381013, 19663667, 19680138, 19706811, 19786649, 20051848, 20425594, 21362767, 21558755, 21882181, 22189703, 22272903, 22385075, 22948895, 23161411, 24321896, 24558090, 24786777, 24867380, 24959596, 25301555, 25617075, 26030479, 26154735, 26345918, 26726843, 27139155, 27367286, 27836897, 28178402, 28364978, 28390289, 28413967, 28469966, 28531278, 28736316, 28739979, 28929822, 29088892, 29161763, 29311252, 29483228, 29629873, 29656442, 29703600, 29706106, 29755695, 29788148, 29854281, 29944850, 29950684, 29959593, 29960864, 30054320, 30144822, 30630371, 30685073, 30726882, 30746134, 30774384, 30954486, 31272714, 31307846, 31449168, 31848994, 9352019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	18758126, 18824714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	21080079		★☆☆☆☆ Found in Text Mining only
Hypertrichosis	HYPERTRICHOSIS	BEFREE	27501129		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	23007030		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21484051, 25279550, 27307356, 31409892	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	26299712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	Pubtator	26299712	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	GWASCAT_DG	29124443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypocholesterolemia	Hypocholesterolemia	BEFREE	31831011		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	16219663	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	16942595, 19782046, 9691433		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	18078864		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	26612624		★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	34313777	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	22439647		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	Pubtator	22439647	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotrichosis	Hypotrichosis	Pubtator	37759728	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10358107, 10389985, 10408392, 10587522, 11115828, 11707426, 11774032, 11912213, 11953885, 11971899, 12110091, 12173346, 12384916, 12401798, 12761217, 12853702, 12900407, 14632212, 14660675, 14702352, 15040022, 15304978, 15342781, 15475194, 15556999, 15588038, 15816564, 15849821, 15951350, 15987743, 16052224, 16085213, 16151532, 16421133, 16543242, 16543245, 16732616, 16849522, 16856880, 16942595, 17028170, 17273772, 17425591, 17609976, 18234850, 18270456, 18508787, 18587495, 18936210, 19265129, 19287200, 19349275, 19412434, 19509297, 19536297, 19542490, 19653907, 19959878, 20026900, 20153296, 20532039, 20729179, 21233846, 21333376, 21357506, 21409457, 21576240, 21629773, 21670155, 21704399, 21731766, 21980393, 21980400, 21986500, 22363134, 22552325, 22705563, 22915762, 22992725, 23144690, 23213275, 23272057, 23303012, 23326384, 23403511, 23549264, 23555666, 23555722, 23852087, 24180698, 24247107, 24319332, 24347168, 24462738, 24586308, 24623967, 24790010, 24825423, 24918449, 25166211, 25630799, 25688362, 25861162, 25988388, 26325091, 26617878, 26800359, 26882120, 26882567, 27232698, 27448695, 27612459, 28045898, 28397725, 28741166, 28806945, 29218693, 29334947, 30659163, 30945361, 31698752, 32403326, 32594304, 32858793, 32945388, 33215223, 33537802, 33811221, 34367731, 34445568, 34663515, 34942165, 35163668, 35611851, 36157928, 36243933, 36982788, 37005305, 37108039, 37446376, 37830546, 37849446, 39323909, 7843420, 8555500, 8917528, 9036922, 9450968, 9525952, 9572397	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11813843, 12161185, 12885785, 14604996, 14676809, 14726398, 15113858, 16219663, 17205120, 17406354, 17608772, 17999771, 18227840, 18283323, 18329003, 18371555, 18618497, 19074987, 19107589, 19139726, 19244479, 19291283, 19540709, 19654314, 19801654, 19802386, 20540786, 20831794, 21048308, 21397301, 21610314, 22172637, 22761861, 22866899, 23098453, 23148666, 23293030, 23509317, 23651517, 23756865, 23788753, 24002598, 24114211, 24634093, 24657063, 24662455, 24959596, 25172328, 25422886, 25644713, 25734817, 26191163, 26193287, 26207380, 26379394, 26585263, 26701969, 26842559, 26873439, 27298257, 27468719, 27604859, 29708435, 29770329, 29997451, 30065361, 30487161, 30876462, 30909668, 31207090, 31588021, 31858546, 32127384, 32351020, 32352161, 32506171, 33067558, 33655764, 33675747, 33737411, 33941139, 34206143, 34292445, 34526760, 35285425, 35302608, 35340230, 35996666, 36006949, 36050755, 36080483, 36140669, 36160709, 36748372, 37752569, 38082346, 8910439, 9751722	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20927579	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	26502822, 29488610		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	16951193, 19351758, 24927770, 27771610		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	14655184		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17510598, 18355767, 18725486, 23867624, 26076038, 28120560, 28478450, 28956952, 29528272, 29946072, 30032282, 30098019, 30142307, 30574088, 30974023, 31190319, 31191356, 31339889		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17044926, 17906365, 19117745, 19381013, 23341966, 25843005, 27757968, 28257817, 28646122, 28661183, 28814429, 28814671, 28915889, 29334947, 29567077, 31217321, 31438928, 31660581, 31699213, 31732480		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18829682, 20483575, 29334947, 31660581, 34522168, 34948231	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20169144, 23341966, 28128990	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	18725486, 30557040, 31847126		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	16179809		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	16526314, 29137483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	31053569		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10213212, 11912163, 14998494, 15374976, 16288493, 18468574, 19834490, 20924124, 23537525, 26094984, 27863212, 28720900, 31005581, 8710899, 9777956		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24338641, 28193596, 28887194, 29248560, 29702127, 29705024, 29710700, 29933741, 30374909, 30661230, 30971896, 31250275, 31472432, 31791659, 31842818		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	11807987, 18287964, 20872175, 26940670, 26957058, 28197761, 28595487, 29193649, 29469063, 29664206, 29790692, 29984822, 30070315, 30323877, 30835573		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	24471989, 26586929	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	16386649, 28332318		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10102229, 16954806, 19926820, 21637825		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21637825, 30892485	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	12032865, 19755858		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22471305, 26871994, 31786572, 32651353, 33274236	Associate	★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	15248828		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	18815217, 29372285, 30995112		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	23317892, 23884772, 24361793, 25209447, 28586059, 29364361, 33764282, 37266623, 38041088, 38095643, 40190527	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27488379, 28495754, 31338931, 31632589		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	23884772, 40190527	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	31632589		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	28260009, 9093829	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11978184	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18273500, 19331191	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18266006, 23303024, 24322015	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18516318	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal obstruction	Pubtator	35528155	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	19762561	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	23728502, 8875484		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	30497276, 37041519, 37573538	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformation	Intracranial Arteriovenous Malformation	LHGDN	16388189		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	21706043, 22643235, 24517927	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhage Traumatic	Intracranial hemorrhage	Pubtator	24067772	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	22085359, 23651727		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27637085, 9613925		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	18087285		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	25001852, 26617878	Associate	★☆☆☆☆ Found in Text Mining only
Intussusception	Intussusception	BEFREE	29643120		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	14674989, 15871723, 16807982, 20697987, 29085497, 29137038, 30888194, 7821921, 9828838		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	27046124		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30892485		★☆☆☆☆ Found in Text Mining only
Irvine-Gass Syndrome	Postoperative cataract syndrome	CTD_human_DG	20577866		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	33076256	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	11029398, 30617840		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	10211994, 17702963, 21737794, 28234972, 29511499, 29842876, 30041898, 30954486, 31132356, 31312121, 9342366		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	22203935, 32576868, 35673992, 37338050	Associate	★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	28404865		★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	25862879		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	19141396		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19369471		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10830746, 10873597, 11050002, 11289142, 11719447, 11727506, 12144897, 12193477, 12620408, 1567395, 15705790, 16641275, 16894293, 16899596, 17483315, 19260835, 19955303, 21421336, 21559457, 25124076, 25631082, 26689971, 28506734, 29985958, 9023368		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	16816927, 23157206		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	14744874		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36051483	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21778999, 25193384		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	10674029, 12631341, 15140761, 19139726, 19295501, 19483746, 19917374, 21978756, 24577260, 25875837, 26722454, 28662688, 30579324, 30719863, 31077056, 34870494	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12872442, 15191350, 15528952, 16046504, 17121786, 17513698, 17545302, 18926584, 19060482, 19139726, 21562766, 21640973, 21868397, 22370607, 23093658, 27598902, 28662688, 29804263, 30579324, 30612603, 30719863, 30726882		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	25951999	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	10469350, 29654395		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15347709, 16526314	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24471420	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	17353160, 18564903, 20501856, 23499421, 29172665, 29399104, 30617840, 30955944, 30976980, 31623576		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	20943766, 22808199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	11448858, 16421229, 18434853, 19060482, 20670331, 21080079, 22370607, 25280384, 25410537, 27081865, 28542479, 29249229, 29353318, 29915853, 30755161		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	16421229, 18455421		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11306510, 12872442, 15949234, 26484606		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	10669954, 19295501, 21886838, 22573349, 23752066, 29022645, 30093597, 31600176, 36176934, 37455529, 38413252	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19483746	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21637343	Stimulate	★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	21718596		★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	27173353, 29048943		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	17183558, 24081562, 26457244, 33099940, 35900477	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	18164965, 28106938, 29523110		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	23071866	Associate	★☆☆☆☆ Found in Text Mining only
Lateral Sclerosis	Lateral Sclerosis	BEFREE	15825252		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	20801723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	20801723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	20801723		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	24321896		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	15732037, 15880336		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17036392, 20443739, 22685266, 28010141, 28338206, 28600036, 34942165, 36313223, 36771423	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27748285	Inhibit	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34256950	Stimulate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	25340839		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29295562	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	22170299		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	27706378	Associate	★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	25362254		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10667597, 10953026, 11705851, 11874628, 11895790, 12529660, 12760284, 15014526, 15471951, 15784722, 15804996, 16034468, 17143492, 22664115, 22993103, 23239744, 24043765, 25179751, 27862460, 29235095, 29495429, 29946742		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11222390, 11877295, 11895790, 11964307, 12843001, 12901974, 12917408, 16164827, 16249383, 20237090, 25422204, 26191229, 29400343, 30909668, 33146708, 35449729, 9058706, 9529385	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11999550, 12481883, 14726393, 16620970, 17577783, 18231921		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	14996703	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11222390, 12404286, 28084439, 28636974, 30909668	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11994978, 12843001, 16249383, 19404919, 19463770, 22664115, 23155356, 23509773, 24966925, 25422204, 29699374, 32783661, 33318617, 9058706	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39993966	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	11222390	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Monocytic, Chronic	Monocytic Leukemia	CTD_human_DG	21535412		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10607717, 11380392, 12094254, 12135675, 12453880, 12702504, 12760284, 12843001, 15158089, 15613103, 16507781, 17169805, 17446561, 17983459, 18245556, 18987662, 19036083, 19320940, 19342098, 19404919, 20380868, 20472832, 20567828, 20578818, 20679526, 20924124, 21209384, 21447743, 22664115, 22833169, 22924417, 23157271, 23239744, 23509773, 25536282, 28053194, 28084439, 28123529, 28636974, 28670885, 28993705, 29137304, 30417360, 30909668, 30959925, 9058706		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11847008, 12453880, 17169805		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	16396768		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11555584, 8563931		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	30323681		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	28424147		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	27541266, 31519596		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	25689256		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18641541		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	28036153		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	17653050, 19491211		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	24521289		★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	BEFREE	28224235		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15788677, 15878754, 17564725, 20155508, 20303008, 21167395, 22321253, 22595944, 22818823, 22836510, 23586368, 24057253, 24833243, 25804797, 27461592, 28145862, 29096753, 29976150, 31711427		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	10553496, 10674029, 14551356, 21978756, 30642877, 31699213		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	37194849	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	21598240, 25973067, 32493092	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10457902, 10636104, 10641751, 10746978, 10938389, 11115828, 11306481, 11764072, 11819727, 11905510, 12017318, 12063553, 12677092, 12700666, 12717391, 12808060, 12810638, 12925952, 14672622, 14966912, 14991930, 14991937, 15133868, 15188178, 15205947, 15531234, 15605080, 15633213, 15809749, 15915456, 16038047, 16534861, 16534867, 16629644, 16675562, 16763805, 16830384, 16951224, 17097688, 17145808, 17167981, 17244253, 17659575, 17931370, 17987801, 18081234, 18537151, 18701503, 18845354, 18924243, 19036703, 19058305, 19177438, 19374603, 19526316, 19558547, 19755510, 19784786, 19821965, 20082870, 20406100, 20430845, 20524035, 20572587, 21093415, 21175812, 21319995, 21427706, 21452000, 21667015, 21805294, 21853101, 22009181, 22289527, 22469593, 22580004, 22581719, 22618716, 22680921, 22768249, 23404364, 23576483, 23636606, 23756865, 23807724, 23838576, 23970062, 24057240, 24138621, 24194905, 24259426, 24363282, 24366206, 24445728, 24510746, 24587407, 24613049, 24632756, 24687551, 24687604, 24823635, 24980078, 25071074, 25123269, 25147179, 25148840, 25286761, 25326336, 25328135, 25333267, 25366785, 25537504, 25553423, 25608619, 25622857, 25730004, 25862879, 25937533, 26048020, 26086159, 26160430, 26278330, 26437261, 26542361, 26612965, 26781989, 26782388, 26823724, 26884845, 27120793, 27541266, 27556821, 27574422, 27641667, 27694002, 27748917, 28011478, 28042950, 28065785, 28078509, 28132823, 28134312, 28147320, 28368741, 28426123, 28452850, 28533682, 28555333, 28587437, 28642869, 28651490, 28651835, 28693887, 28741166, 28789459, 28837651, 28849033, 28915658, 28968425, 28975984, 29039561, 29067114, 29107835, 29156827, 29286122, 29316206, 29340079, 29433850, 29464101, 29520435, 29552121, 29629949, 29740493, 29808997, 29854577, 29866133, 29888133, 29904424, 29917189, 29957468, 29972759, 30008920, 30109780, 30114953, 30132576, 30214582, 30293733, 30310256, 30352941, 30362374, 30439360, 30479372, 30506570, 30520543, 30521872, 30569112, 30600478, 30643357, 30671808, 30697069, 30726882, 30740671, 30810974, 30879152, 30925457, 30935424, 30952770, 30977418, 31006280, 31139312, 31173855, 31179333, 31195212, 31258881, 31289995, 31293977, 31353727, 31490422, 31519596, 31638892, 31726461, 31757187, 31790004, 31799179, 31807025, 31816265, 31830994, 8617424, 9242380, 9646228, 9657098, 9744316, 9828211, 9917513		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12667326, 12700666, 14672622, 15040022, 15161709, 15188178, 15217952, 15334691, 15633213, 15742396, 15809749, 16830384, 17167981, 17393111, 17659575, 17974148, 18031381, 18617766, 18701503, 19016764		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11115828, 17244253, 19589268, 21319995, 23970062, 24057240, 24390792, 24687551, 25862879, 26782388, 28837651, 31139312, 31490422, 31790004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	11981751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	LHGDN	14669345, 15742396, 17786144, 18656381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	15742396, 26299203, 27982164, 28837651, 29055924, 29604220, 33673041, 36853298	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11710707	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	16636650, 17353160, 17786144, 18193117, 18814928, 28837651, 35349405	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	CTD_human_DG	16757304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	18814928, 33647018	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	21175804	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	BEFREE	30080721, 30853494		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure Acute	Liver failure	Pubtator	21175804	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11819727, 14672622, 15531234, 16675562, 16831601, 23172681, 24613049, 26437261, 27287476, 28378824, 28452850, 28651835, 29266245, 29854577, 8617424, 9284816		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	35426263	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	11813843, 12668796, 16546368, 20348277, 22795057, 26424968, 34717573	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	15113858	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	17044926, 19189846, 23656623, 23756092, 29695053, 29703138, 31421589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	CTD_human_DG	23618901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	31732480	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29695053		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10646866, 10702410, 10741721, 15777969, 16899604, 17024232, 20027628, 20596059, 22275507, 23275310, 25889301, 27226640, 28122267, 28298068, 28633995, 28818987, 30092405, 30444717, 30885340, 9863024		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10870646, 10925736, 11092527, 12161185, 12209728, 12576459, 12845630, 17024232, 18590539, 18671849, 19337377, 20349288, 20712888, 22231433, 22320189, 22355056, 22593690, 23665907, 24321786, 26424968, 26912193, 27232698, 27541266, 27709850, 28720067, 30194450, 30563405, 30674935, 30682194, 31002164, 31298335, 32209219, 32354326, 32521872, 33015794, 34717573, 36917086, 37005305, 37830546, 9376264, 9683299	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15329326, 15704107, 15935515, 15945504, 16269156, 16982461, 17505039, 17671690, 18242763, 18281657, 18827607		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25919050, 26109366	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28343620, 28755405, 31292886		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17964973	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20805419, 28343620, 35864995	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28343620, 28755405, 31292886		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18991188		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20670331, 25359881, 28343620, 28619073, 28755405, 29271478, 29756413, 30902069, 31046570, 31292886, 8738799		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	19295501, 20670331, 27598902, 30755145, 30902069, 31046570		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	19295501, 20805419	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	19483746, 36335193	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28343620, 28755405, 31292886		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	22788941, 30623243		★☆☆☆☆ Found in Text Mining only
Lymphangioma	Lymphangioma	BEFREE	11742043, 31013538		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10424737, 11511786, 11687953, 12854133, 12854174, 14669355, 15029262, 15112337, 15741767, 16799477, 16807982, 17972532, 18023103, 20205278, 20459642, 20546613, 20953377, 21708009, 22126484, 22246794, 22994764, 23625175, 24507679, 24803825, 26058869, 26111775, 26526574, 26676225, 27342370, 29077165, 29137038, 29914006, 29917190, 30010108, 31173290, 32048177, 32615729, 32899018, 33954191, 34693869, 36327483, 36946265, 9376264, 9635853, 9823983	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11092527, 12174362, 12460468, 14657950, 15309707, 16827115, 17094486, 17353919, 17409493, 17461470, 17785951, 18200665, 21316013, 21718596, 22644676, 25624724, 26099724, 27413748, 27936049, 28476037, 29049198, 36529788, 36581931, 36873124	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	12941820, 15930292, 16230387, 18200665, 18519975, 21089052, 22082308, 22644676, 26706909, 27352182, 27602496, 30150039		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	17203176, 17409493, 19023980		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11426493, 15311211, 16156857, 17998899, 19821819, 22322190, 26121143	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11999550, 12038454, 17392174, 17671709, 18006812		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15311211, 17671709, 19016766, 22882209, 24583314, 25810565, 25846106, 26121143, 26503641		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	21926965		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	19701853		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11697501, 11841410, 19649652, 19701853, 23998120, 24885312, 25810565		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	12607599, 14959852, 15120936, 17454603, 18190463		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11841410, 19649652, 19701853, 23998120		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16932349, 28119994		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	16932349		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	19386604, 19834034, 20019880, 20228934, 20811156, 21566137, 21597483, 21878851, 21917937, 22312192, 22355348, 22408008, 22419845, 23112570, 23337555, 23559864, 23569009, 23745581, 24652518, 25558172, 26088137, 26330749, 26654980, 26854823, 27069359, 27783271, 27892514, 28835685, 28926193, 29565837, 29579408, 29852030, 30696427, 30934838, 31080113, 31226340, 31583032, 31633290, 31700227, 31857597, 31992792, 32106279, 32155173, 32191267, 33172148, 33260857, 33510953, 33876574, 33921543, 34003896, 34061866, 34205419, 34577897, 34721402, 34750590, 35027571, 35326447, 35661979, 35682771, 35693737, 35714567, 36875133, 36899935, 37373474, 39260060, 39273697, 39959171, 39959181, 9059252	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular degeneration	Macular Degeneration	BEFREE	20887247, 31615077		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	27009515, 28266609, 30820144, 32579694, 33075294	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	28231837, 33113897, 34794403, 35370941	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular dystrophy corneal type 1	Macular dystrophy	Pubtator	34794403	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	14551356, 18319288, 25528859, 30632181		★☆☆☆☆ Found in Text Mining only
MACULAR DYSTROPHY, PATTERNED, 3	Macular dystrophy, patterned	BEFREE	27474146		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	18421240, 23959876, 24319335, 24451141, 25737631, 25923230, 26054568, 28100839, 28328965, 28402713, 28931763, 29049410, 31191997, 31732812		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	CTD_human_DG	20577866		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	LHGDN	17895817		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	18421240, 22721706, 23959876, 24319335, 24451141, 25737631, 25923230, 26054568, 28100839, 28402713, 28931763, 29049410, 31191997, 31732812		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	CTD_human_DG	20577866		★☆☆☆☆ Found in Text Mining only
Maculopathy with diabetes mellitus	Diabetic maculopathy	BEFREE	28683455, 29687595		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	31823655		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17257729, 19700204, 20417690, 24718046, 26726958, 27527872, 28267147, 28340040, 28448948, 29725086, 30033161, 30406404, 31057436, 31103810, 31823655, 31827384		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	17257729, 19700204, 20417690, 23333658, 24718046		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	31567367		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	14605672		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10682677, 11303624, 11507079, 15700836, 16612574, 16951188, 16964394, 17473188, 17570036, 20046875, 21116837, 21204766, 24781871, 25072110, 25353068, 26362401, 26473373, 26826105, 28000842, 28812437, 28901452, 29765561		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10897108, 11078794, 11326316, 15155138, 15330158, 16641910, 19082496, 19663672, 20098841, 20204302, 21480395, 22987573, 24057180, 30804145		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	16499871		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	20029173, 23537525		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	BEFREE	31380420		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11493335, 11804869, 12594815, 17214348, 19505392, 21842119, 27783867, 29104239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	27882487		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10375015, 10967114, 11156525, 11175850, 11245489, 11280795, 11306513, 11336478, 11559575, 11571649, 11899364, 11929808, 12208749, 12378509, 12591731, 12736564, 12845639, 12851730, 14520689, 14695189, 14715109, 14726684, 15014023, 15026804, 15168728, 15173272, 15274325, 15280403, 15519527, 15592523, 15609122, 15609132, 15736439, 15860260, 15897560, 15949894, 15958542, 16084894, 16267616, 16397053, 16613616, 16775174, 16954424, 16978872, 16985052, 17010208, 17471570, 17550303, 17636397, 17695512, 17698375, 17891484, 18171601, 18568347, 18630531, 18671839, 18790743, 18821062, 18824714, 18825410, 18987982, 19162240, 19196101, 19242105, 19283869, 19291283, 19340614, 19398483, 19429439, 19553068, 19671742, 19766100, 20047302, 20112503, 20307196, 20449668, 20563637, 20571871, 20631064, 20652396, 20686367, 20714802, 20830515, 20848232, 21119072, 21127992, 21193031, 21194429, 21204912, 21249429, 21284259, 21291529, 21546870, 21731759, 21734015, 21798757, 21927028, 21984182, 22000946, 22095586, 22237711, 22258476, 22315135, 22542663, 22561350, 22640261, 22644871, 22800822, 22907703, 22993299, 23054001, 23092556, 23123638, 23146280, 23203097, 23212515, 23224595, 23232696, 23254958, 23289900, 23390884, 23625573, 23631762, 23679262, 23695548, 23711825, 23725153, 23728336, 23750285, 23752185, 23832257, 23846253, 23904001, 23907365, 23926105, 23981902, 23991063, 24265228, 24357345, 24377619, 24390659, 24401996, 24464787, 24528036, 24535190, 24595984, 24615579, 24659092, 24680191, 24687553, 24816918, 24875759, 25106408, 25148899, 25152223, 25230850, 25281903, 25333258, 25412937, 25448984, 25560472, 25579062, 25604142, 25620657, 25772243, 25972323, 26052072, 26067906, 26080815, 26100253, 26173622, 26239613, 26287601, 26345822, 26416045, 26805761, 26848522, 26882471, 26919112, 26988756, 27107086, 27195611, 27323060, 27362808, 27649142, 27771839, 27775427, 27988457, 28045923, 28051026, 28062977, 28119364, 28183251, 28220020, 28240006, 28252641, 28274247, 28333356, 28443023, 28476037, 28509606, 28534941, 28550685, 28558368, 28606050, 28615679, 28643744, 28652379, 28677228, 28697175, 28714000, 28741069, 28744693, 28752859, 28780387, 28860767, 29088842, 29100335, 29115538, 29136509, 29137038, 29179185, 29221123, 29230610, 29340882, 29367761, 29391899, 29403376, 29434864, 29497310, 29699375, 29705024, 29717062, 29730399, 29874563, 29970508, 29970908, 29971782, 30003393, 30008856, 30063723, 30105032, 30259245, 30314513, 30405852, 30439625, 30594607, 30629215, 30722112, 30788837, 30818220, 30867566, 30888194, 30930461, 30939479, 30947677, 31023337, 31028743, 31228519, 31254605, 31635541, 31746369, 31824163, 7821921, 8616842, 8619189, 9458078		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10468067, 10816575, 11957147, 12782015, 12942123, 15917160, 16267616, 19148513, 19819950, 20127022, 21363919, 22178239, 22711307, 22904162, 23176363, 23985752, 25231075, 25981814, 27770434, 28969913, 28991928, 29024813, 29033580, 29133593, 29155953, 30488858, 30863089, 31587503, 31677820, 9032563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10376985, 10457902, 12119553, 12239588, 17511025, 18837095, 19366059, 19584152, 20181455, 22994764, 23838139, 24206575, 24284961, 24654773, 25640399, 27340350, 28186102, 28435293, 28536606, 29805549, 31289557, 31824776, 9683819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	11584965, 16489641, 18676870, 23653380, 23962084, 24185122, 28212293, 29599313, 30272364, 31002375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24474253, 28594907, 30636586		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11089881, 18039096, 18799497, 19402056, 20554520, 20723915, 20973793, 21886838, 27395374, 28166200, 28479237, 28491148, 29371637, 29554654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	15739081, 27927251		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	16038047, 18174379, 18452647, 18929564, 21853101, 23852809, 24114200, 24330582, 25147179, 25176394, 28123525, 28407034, 28975984, 29720833, 29808997, 29888133, 30534696, 30686547, 30911540, 31353727		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10675482, 10918604, 11092527, 11208836, 11589304, 12136423, 12576459, 12736723, 12845630, 15767331, 15870864, 17024232, 17044926, 17505039, 17671719, 17906365, 18281657, 18359110, 19223090, 19291283, 19324447, 19337377, 19339077, 19509262, 19853959, 20027628, 20087356, 20187798, 20208480, 20489156, 20497582, 20712888, 21283766, 21610170, 21712447, 21854359, 22231433, 22236877, 22320189, 22431315, 22789825, 22795057, 23275310, 23288726, 23462173, 23982876, 24008975, 24098368, 24146275, 24647869, 25125500, 25184262, 25335740, 25425729, 25468805, 25773840, 25889301, 25912305, 26065377, 26094984, 26406951, 26542886, 27364335, 27423680, 27541266, 27709850, 27930983, 27981753, 28122267, 28335793, 28626164, 28656083, 28720067, 28749108, 28831824, 28861767, 29434884, 29675110, 29775813, 29904944, 29928404, 29970531, 29983647, 30013987, 30222960, 30518184, 30539834, 30563405, 30682194, 30807551, 31059086, 31091971, 31516609, 31559061, 31572671, 31764844, 31770191, 8589021, 9683299, 9816315, 9863024		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15788677, 15878754, 17564725, 20155508, 20303008, 21167395, 22321253, 22818823, 22836510, 23586368, 24057253, 24833243, 25804797, 27461592, 28145862, 29096753, 29976150, 31711427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	16139912, 30430078		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10901370, 11494038, 11774259, 11804750, 11839574, 12114428, 12466143, 12529984, 12668280, 12684660, 12810677, 12874030, 14719060, 15087251, 15213310, 15867217, 15897235, 16152587, 16886597, 17010410, 17289129, 17289883, 17419711, 17498666, 17559911, 17717144, 18182107, 18337445, 19005980, 19253105, 19509553, 19775995, 19838928, 20130421, 20832104, 21041183, 22210436, 22579791, 22700681, 23029477, 23254909, 24075030, 24141405, 24236050, 24761768, 24815691, 25176450, 25296882, 25374251, 25577253, 25637316, 25835351, 26531153, 26610586, 27064283, 27401249, 27483433, 27498762, 27852039, 27943222, 28008951, 28179359, 28289938, 28301874, 29048687, 29069849, 29075785, 29218693, 29721047, 29904943, 30066848, 30093968, 30348916, 31639291, 7707437, 9426398, 9777956		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10188906, 10457902, 11291072, 11358838, 12136423, 12370751, 12499918, 12545153, 12553038, 14604996, 14639356, 15026340, 15374992, 15674201, 16109537, 16482630, 16525644, 16807445, 16885366, 17145834, 17356708, 18307536, 18350635, 19208748, 19437103, 19908168, 20023433, 20118543, 20482858, 20927318, 21382954, 21408027, 21729304, 21737511, 21885862, 22016776, 22084065, 22207048, 22472348, 22580114, 22906006, 23254994, 23422754, 23467576, 23719599, 23729403, 23745588, 23924856, 26820381, 27426724, 27637085, 27986626, 28338114, 28916756, 28943931, 29963167, 30027561, 30091943, 30333153, 30861616, 30914029, 31087222, 31638231, 9815813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10893635, 10953325, 11074523, 11176459, 11326314, 11519827, 12039075, 12067976, 12168088, 12445237, 12496487, 12840218, 12893367, 14744778, 14871830, 15150085, 15161648, 15616600, 15651067, 15701844, 15754342, 15905202, 15956982, 16193288, 16267000, 16322239, 16530725, 16568082, 16606632, 16638750, 16740695, 16740700, 16826426, 16908180, 17127464, 17142033, 17216542, 17237281, 17310988, 17409440, 17547528, 17914566, 17917789, 18398039, 18514506, 18612129, 19089921, 19106642, 19242850, 19495772, 19755511, 19903767, 19908237, 19923922, 20096741, 20519274, 20564320, 20861185, 21306303, 21343372, 21427164, 21555367, 21965736, 22105769, 22549243, 22705563, 22777769, 22815235, 22850906, 22855159, 22952749, 23185615, 23359392, 23369005, 23384557, 23831623, 24005860, 24066029, 24127038, 24177231, 24240584, 24353087, 24435801, 24787994, 24858271, 24865426, 25446255, 25586350, 25724697, 26160610, 26868935, 26995304, 27322147, 27448695, 27527525, 27669423, 28225015, 28241827, 28259690, 28277613, 28335793, 28387458, 28394264, 28720900, 28974155, 29268703, 29315957, 29371637, 29380900, 29391897, 29441606, 29563805, 29707793, 29781343, 29969844, 30053596, 30059715, 30178447, 30186533, 30367880, 30402678, 30459931, 30989489, 31177128, 31383249, 31387585, 31600936, 31649488, 31667686, 31679299, 9067270		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12893367, 16606632, 16908180, 20052738		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	28102887		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12058259, 23166713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11819817, 11857038, 12767510, 14532971, 14710231, 15112337, 15112366, 15349119, 15746037, 17094412, 17111394, 17334712, 17426061, 17465445, 17671399, 18200665, 18373164, 18383582, 18708754, 18972599, 19496079, 19566948, 19581046, 19676106, 19835575, 21161943, 21286666, 21344505, 21633597, 21769478, 22292637, 22460086, 22729879, 22808003, 22895814, 23264084, 23573305, 23625175, 23728938, 23801279, 24401755, 24744582, 25096402, 25320512, 25444928, 25596740, 25847144, 25886574, 26115478, 26250887, 26398764, 26566627, 26937132, 27224240, 27280289, 27352182, 27976952, 27993216, 28281844, 28362978, 28459196, 28581513, 28730780, 28738343, 29142602, 29228421, 29344744, 29390928, 29391882, 29399168, 29706652, 29761299, 29853970, 29914006, 29960070, 30010108, 30380970, 30410610, 30980943, 31117964, 31611999, 31725767, 31749879, 31811909, 31850212		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14602779, 15994743, 16398617, 16940797, 17951537, 20142332, 21093207, 22066479, 22711876, 24687553, 25971967, 26244545, 27067785, 31174237, 31186313, 9360534		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	17174141		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11350893, 11953885, 11980898, 14713761, 15667866, 15947684, 16914569, 17319747, 17628298, 18425331, 18513850, 19088043, 19190164, 19424629, 20978160, 21292509, 21632885, 23009795, 23243026, 23430447, 23613251, 23749886, 24402583, 24448324, 25792473, 26197083, 26544730, 27196763, 28109084, 28206971, 28209239, 28423532, 28687357, 28710377, 29277778, 29959793, 30195633, 30533316, 30609111, 30655756, 30849545, 30909190, 31231785, 7545086, 9823778		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10213212, 10373662, 10375015, 10443829, 10457902, 10490819, 10547592, 10661874, 10690548, 10742156, 10779196, 10873096, 10918604, 11078794, 11092527, 11274009, 11280779, 11291072, 11358838, 11483411, 11529880, 11551414, 11774032, 11774259, 11804877, 11806643, 11833093, 11846001, 11873861, 11880187, 11905783, 11938453, 11960372, 12014632, 12085210, 12136423, 12161185, 12177445, 12189553, 12239588, 12298426, 12359754, 12429975, 12460925, 12498992, 12499918, 12553038, 12598314, 12668280, 12684059, 12778165, 12810638, 14572781, 14603252, 14669355, 14695215, 14708636, 14744778, 15034795, 15086970, 15102658, 15113858, 15133868, 15150085, 15161682, 15256456, 15294883, 15474339, 15563310, 15567744, 15581913, 15592500, 15669079, 15704107, 15777969, 15788677, 15817666, 15919761, 16007214, 16040218, 16109537, 16258261, 16260429, 16299798, 16398617, 16432214, 16525667, 16556023, 16613616, 16675573, 16685275, 16702519, 16773190, 16775174, 16831481, 16908180, 16935322, 17024232, 17027147, 17034851, 17094433, 17111394, 17203773, 17214745, 17235307, 17237427, 17289129, 17289883, 17319747, 17341611, 17381350, 17471570, 17498666, 17548263, 17549406, 17564725, 17630057, 17726104, 17764071, 17891484, 17909625, 17938959, 18158776, 18234958, 18339868, 18350635, 18396013, 18398429, 18485799, 18486981, 18498284, 18514506, 18519975, 18613756, 18633446, 18719377, 19011936, 19014781, 19080330, 19148469, 19192961, 19208835, 19221001, 19240164, 19253105, 19342157, 19401451, 19429439, 19431143, 19492417, 19566820, 19596939, 19649652, 19706811, 19765808, 19811770, 19816815, 19819950, 19834490, 19887629, 19903767, 20030694, 20042679, 20082870, 20103650, 20181455, 20195243, 20303008, 20400478, 20462514, 20497582, 20501615, 20501856, 20514493, 20519274, 20538607, 20554520, 20594200, 20618614, 20635170, 20660740, 20662003, 20797778, 20884743, 20890966, 20973260, 21046425, 21071450, 21093207, 21098094, 21102434, 21115742, 21119072, 21126687, 21167264, 21167395, 21174216, 21204912, 21245940, 21343374, 21349994, 21378364, 21411713, 21426933, 21427557, 21447743, 21452000, 21468552, 21491998, 21496199, 21504321, 21548585, 21558755, 21567098, 21610170, 21638208, 21692070, 21698469, 21740084, 21776026, 21777997, 21853101, 21858763, 21983283, 22045472, 22054419, 22167330, 22183643, 22210436, 22258871, 22273580, 22350700, 22356893, 22385510, 22442268, 22484977, 22542663, 22582814, 22626276, 22644676, 22693250, 22705563, 22733538, 22761647, 22761861, 22773560, 22818823, 22853925, 22855159, 22872931, 22895562, 22901561, 22932900, 22956610, 22963500, 22992725, 22993103, 22994764, 23009795, 23076130, 23094058, 23123638, 23169760, 23178531, 23193956, 23203097, 23257828, 23326571, 23358650, 23426184, 23427297, 23447383, 23548264, 23573305, 23593187, 23629668, 23707765, 23749886, 23790316, 23831623, 23845470, 23870899, 23907365, 23908598, 23913375, 23926105, 23950958, 23966157, 24013786, 24025538, 24029605, 24088136, 24098368, 24114199, 24114200, 24138621, 24165321, 24185122, 24203759, 24205206, 24240584, 24330582, 24401755, 24401996, 24403062, 24465898, 24522185, 24535190, 24569074, 24721321, 24805287, 24815691, 24894645, 24927229, 25049425, 25123269, 25135429, 25213694, 25230850, 25310988, 25316815, 25328135, 25398804, 25560471, 25586350, 25589622, 25624724, 25644713, 25673364, 25700172, 25724697, 25769726, 25773809, 25797700, 25937206, 25937533, 25944623, 25948774, 25967458, 26001391, 26014353, 26093379, 26155940, 26158818, 26160610, 26232913, 26264619, 26285742, 26307351, 26342107, 26345754, 26402225, 26412785, 26437261, 26535706, 26542361, 26588727, 26648523, 26706021, 26761211, 26805761, 26848522, 26861159, 26886256, 26967562, 27012389, 27067785, 27100727, 27176787, 27363442, 27364975, 27374091, 27387303, 27401249, 27466356, 27474395, 27542820, 27549123, 27580750, 27693125, 27694002, 27727447, 27756837, 27862460, 27886571, 27943279, 27967265, 27980109, 28088074, 28102286, 28133920, 28215534, 28216250, 28218903, 28231410, 28240006, 28260607, 28274247, 28322131, 28326867, 28347226, 28348255, 28350162, 28358369, 28368412, 28377452, 28402004, 28463787, 28466607, 28504716, 28529319, 28536029, 28544312, 28558368, 28574932, 28594907, 28601126, 28615679, 28617188, 28627973, 28655794, 28693213, 28736316, 28789459, 28831824, 28842748, 28855350, 28860767, 28861767, 28882537, 28923947, 28937681, 28952293, 28975984, 28982661, 28985230, 28994095, 29048687, 29065985, 29078273, 29079348, 29088724, 29096753, 29133593, 29143774, 29161763, 29184575, 29187438, 29198078, 29210417, 29212191, 29220293, 29225138, 29296234, 29308068, 29344214, 29344235, 29366307, 29371698, 29397867, 29401587, 29408327, 29416649, 29441713, 29449267, 29465130, 29475966, 29519591, 29521047, 29523110, 29532881, 29562227, 29575299, 29641253, 29655782, 29656061, 29659486, 29662489, 29666026, 29668679, 29707135, 29717062, 29724868, 29730399, 29760791, 29776963, 29800478, 29881420, 29917189, 29959593, 29970508, 29978839, 29983564, 29985074, 29989021, 30014486, 30015973, 30024080, 30063723, 30093597, 30134286, 30195633, 30226540, 30228246, 30327408, 30327999, 30357530, 30380970, 30384408, 30397360, 30410348, 30411685, 30456891, 30468760, 30472294, 30501381, 30520094, 30529768, 30534696, 30539828, 30572521, 30605014, 30652389, 30678134, 30694269, 30708140, 30720077, 30726882, 30753341, 30837171, 30848190, 30861616, 30871059, 30894166, 30904360, 30939479, 31001696, 31004710, 31035945, 31078463, 31131561, 31156623, 31167931, 31229276, 31235595, 31272709, 31289363, 31305525, 31311559, 31360304, 31380271, 31473473, 31492751, 31516609, 31519206, 31564024, 31588240, 31595395, 31615077, 31624989, 31648565, 31678280, 31717527, 31744780, 31750487, 31757048, 31766246, 31777532, 31791385, 31841190, 7478581, 7553632, 7738351, 8527839, 8667614, 8910616, 9036922, 9346879, 9635853, 9683299, 9683819, 9777955, 9815703, 9815760, 9815813, 9839443, 9917513, 9918214		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	18494554		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	18679811, 20686603, 21540237, 25833823, 25955218, 26146864		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10448304, 12189553, 12821346, 15368588, 17549406, 17678892, 19352388, 19566820, 20797778, 21163514, 21222176, 21546870, 23193915, 23861821, 23963849, 24297386, 24782650, 25061734, 25135429, 25541433, 25855930, 26067630, 26526574, 28177889, 28720059, 29247526, 29344192, 29654110, 29666026, 29928441, 30037277, 30338794, 30458457, 31035945, 31452725, 31704874		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10408390, 10457902, 10519388, 10690548, 10738243, 11833093, 12209585, 12374697, 12379772, 12429975, 12810642, 14996738, 15490972, 15883203, 15930362, 16006751, 16127434, 16254106, 16543245, 16618894, 17488804, 17695550, 17879399, 18365547, 18494554, 18505065, 18544566, 18613756, 19292890, 19492417, 19697322, 20532039, 20950431, 21091242, 21098094, 21468552, 21766497, 21775090, 22509371, 22992293, 23518595, 23536895, 23794399, 24165321, 24213572, 24555920, 24780003, 25224594, 25371074, 25423914, 25740061, 26209639, 26379394, 27353863, 27887848, 28245709, 28245762, 28415573, 28445620, 28683891, 28738498, 28966326, 29079348, 29084916, 29282362, 29630948, 29709588, 29845255, 29894822, 29907957, 30639585, 31127996, 31348616, 31420015, 31717527, 7535799, 8757194, 8909524, 9422768, 9622060, 9731515		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	18987561		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10772888, 11306513, 11336478, 12579315, 15014023, 15532726, 15845615, 16825198, 16954424, 17550303, 18284215, 18554584, 18726892, 19242105, 19553068, 20504328, 20594639, 23123638, 23257828, 23667446, 24357345, 24535190, 24837366, 24899149, 25971960, 26467629, 26559373, 26848522, 26919112, 27176787, 27554339, 28008154, 28765266, 29109792, 29212519, 29609579, 29652061, 29986606, 30541574, 31786855, 8619189, 9203508, 9458078, 9607631		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11836562, 12163680, 12232762, 12446667, 12591731, 12687277, 12788875, 12883688, 14647449, 14735189, 15073116, 15168728, 15609122, 15609132, 15646833, 15845615, 16482999, 16596190, 16650817, 16775174, 17112680, 17353919, 17550303, 17676480, 17914573, 18188715, 18210198, 18366667, 18438343, 18554584, 18570923, 18824714, 18826631, 19023980, 19047116		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20029173, 23537525		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	11213831		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	10547592, 12939742, 17374440, 20594200, 30608431		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	33687603	Stimulate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	12000716, 20716170	Associate	★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	29730395, 29772306		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10200298, 18445656, 20368568, 21422803, 22343387		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	17704359, 25794107, 33589929	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20883786, 23082872, 25794107, 28302031, 31063715		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10197632, 10397264, 10414467, 10416597, 10541969, 10805219, 10842189, 10937546, 11438469, 11585767, 11809675, 11912163, 12205045, 12939465, 14500375, 14612518, 14632212, 14660675, 15009718, 15039211, 15126605, 15166498, 15610528, 15671530, 16179869, 16181451, 16489061, 16804907, 17595666, 19047140, 19478386, 19713740, 19965691, 20194633, 20208480, 20354907, 20431030, 20927579, 21109946, 21233846, 21389833, 21624769, 21654344, 22418780, 22904678, 22926523, 23204132, 23318885, 23707237, 23938462, 24126726, 25597785, 25769726, 25862867, 26484566, 26667022, 27476721, 27549123, 27572607, 27821803, 27878290, 28219779, 28404865, 28740548, 28756123, 28885396, 28984690, 29346400, 29362221, 29755400, 30061268, 30408085, 30575644, 31069961, 31227006, 31354297, 31403867, 31427543, 31654655, 8548760, 8644861, 8833917, 8994354		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10414467, 10873988, 11121133, 12404291, 14632212, 14660675, 15610528, 16801397, 16946713, 17595666, 18288398, 18996182, 19240164, 19478386, 19794965, 20004943, 20208480, 20685877, 20927579, 20949875, 21233846, 21544800, 22124101, 22429778, 23318885, 24766647, 24868139, 24920276, 25089267, 25560632, 27549123, 30408085, 32718103, 33118214, 33506034, 34367731, 35011253, 36539575, 37371032, 7744769, 9328154	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11809675, 12058259, 14512791, 14634801, 15453815, 15610528, 15671530, 18363112		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17932890, 31758648, 34354552, 35538545	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma, Amelanotic	Melanoma	LHGDN	14634801		★☆☆☆☆ Found in Text Mining only
Melnick-Needles Syndrome	Melnick-Needles Syndrome	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	14655184, 30554801		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	20801723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	30127118		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10451490, 10729630, 15949234, 17013629, 17570036, 18317686, 19614683, 20052595, 21426933, 21968684, 23398358, 23651727, 24980036, 26413777, 27779709, 29410063, 29858948, 30253729, 30556741, 31653130, 7532545, 8929501		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18317686		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20052595, 23047550, 23818357, 25681310, 25821815, 29858948, 32756218, 33099292, 40652475	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	33528717	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17257729, 19423950, 19571140, 24636631, 24718046, 26556286, 27527872, 28267147, 29574217, 29731825, 29968119, 31103810, 31830487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22954336, 23623252, 24636631, 24718046, 25474224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	31842818		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	18408656		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11804869, 12594815, 20651338, 26308799, 28690011, 31670317		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23585849	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	10487612, 16619474, 17214348, 20838437, 24790010, 34261675	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	22124604		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32160900	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19223316, 25423914, 28191276, 28212431, 28763032, 31405227, 31786572, 32160900	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19223316, 25423914, 27984191, 28212431, 28521866, 28800322, 29067980, 29733969, 29891039, 30107490, 30367505, 30614120, 31786572		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	10805219, 19240164, 19909248, 25010863, 28103611, 29943192, 30408085		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	14871830		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	27977881		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	16546368	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20482220, 22865486, 28918499		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	28918499	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	17105389, 29255164, 29710700, 30278247		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	11175851, 11435313, 17945164, 23410910, 29896974		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	15820807, 21071334, 21126911, 21257617, 21458805, 22402207, 23211130, 23900206, 27109751, 29221937, 29685073, 30832584		★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	20665500		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34424263	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	Pubtator	33655764	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	21573104		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	17487399		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15130943, 27697660, 29589107		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	21721043		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	21721043, 23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor neuron atrophy	Motor neuron atrophy	BEFREE	11381259, 14556945, 15184633, 16410746, 16784838, 16856151, 18413368, 18923022		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15003169, 16784838, 17636250		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12095505, 19324337, 28811677	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22836510, 25804797, 31711427, 36172677, 38376273	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	37098452	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	21631222, 23077562, 26861126, 27462098, 28596558, 29633884, 30392834		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	23077562, 28596558, 30392834, 36674749, 37684266	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	21631222, 23077562, 26861126, 27462098, 28596558, 29633884, 30392834		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	12596060		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	LHGDN	18043973		★☆☆☆☆ Found in Text Mining only
Mucinous carcinoma of breast	Mucinous Carcinoma Of Breast	BEFREE	29085497		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	11839635, 15470196, 18297377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15470196, 16645995, 17874221, 18297377, 21905000, 30054763, 30178831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	32808647	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34434074	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	19116756		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	19238077		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	23106811		★☆☆☆☆ Found in Text Mining only
Multiple Epiphyseal Dysplasia	Multiple Epiphyseal Dysplasia	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Multiple fibrofolliculomas	Multiple Fibrofolliculomas	BEFREE	23356225		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10753844, 11435313, 11751905, 11830495, 12101201, 12714512, 14717786, 16278310, 16487170, 17981009, 19383353, 20652971, 24141333, 24374814, 25769101, 26909624, 27510016, 27983725, 28008160, 28380424, 33152124, 33200797, 33416146, 35677537	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11435313, 11830495, 12135668, 12469200, 14513045, 14513053, 14998494, 15217829, 15492276, 15863274, 16166312, 16926633, 17016437, 17164332, 17428175, 17614789, 17622469, 17935668, 18174379, 18458152, 18559525, 19196658, 20331634, 20404562, 21474670, 21534877, 22139971, 23104180, 23113684, 24402435, 24687381, 24903015, 24995304, 25353275, 25370722, 27023728, 27983725, 28380424, 29109769, 29359239, 29568363, 29589107, 30534560, 30845824, 30948485, 31024851		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11940485, 12393542, 12574959, 12604407, 14513045, 14513053, 15458509, 15583754, 18449811		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16258629, 20097882, 24355943	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24091729	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16295526	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17015745, 17083617, 19493574, 21573104, 22653056, 25887968, 28401369, 31652374		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21573104	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27424135	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	21573104	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	21573104		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28334037, 30711624		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	11847008, 16396768		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15804996, 16396768, 20679526, 21553011, 21878936, 23341958, 26637787, 27897450, 28636974		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10604739, 11222390, 12100142, 23155356	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20679526	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	17442379, 21217153		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21360018, 21535412, 24183807, 28968948		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	CTD_human_DG	21535412		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	11877311, 16263579, 18534064		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12040448, 14976047, 15158098, 15291801, 15784722, 17581794, 19875757, 20952060, 24129092, 25831205, 26476544, 26502845, 27612952, 30662269		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	11891801, 14530810, 16263579, 18024322		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	19466975, 21217153, 28554272		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	17942913, 19157636, 19219619, 23525453, 27565928, 28591698, 28927127, 29235400, 29297985, 29371913, 29693703		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	14530810	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	29462614, 29783929		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	15732037, 15880336		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10732896, 23155356, 26861446, 27835972, 34799616, 35378513, 39766291	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	11399901, 15510173, 15937083, 16454353, 16996002, 17264508, 19167769, 19307480, 19332989, 19794062, 20019242, 20139114, 21091632, 21362767, 21944383, 22038108, 22103127, 22950427, 23081990, 23692382, 26146616, 26592497, 26662939, 26861446, 27835972, 28122306, 28186692, 28284103, 28646793, 28662151, 28669772, 28724653, 28757887, 28810603, 28821329, 28882731, 28966327, 29038511, 29101176, 29266144, 29387016, 29503239, 29525602, 29752623, 29771427, 29920798, 30093864, 30371196, 30460984, 30504732, 30531686, 30656600, 30705637, 30786776, 31075259, 31116952, 31194009, 31527337		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	19019194, 25417001, 32399898, 34275376	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	10400771, 10426872, 10865845, 11166270, 11195786, 11426585, 11711525, 11728604, 11773594, 12499610, 12582471, 12907944, 14963670, 15331549, 15337699, 16990600, 18373738, 19307480, 20607367, 21332365, 21362767, 23639291, 24047149, 28765276, 28924218, 29101176, 29478261, 30035366, 30317903, 30786776, 8756616, 9860779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	11279416	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	14503966, 14583313, 15347709, 16214533, 9860779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	15770733, 20847963, 21206178, 22643235, 23926105, 24047149, 28765276, 32596444	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	BEFREE	28103602		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	31776299, 37759728	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	20801867, 23840094, 30142763	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	31019965		★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	29421985		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26211001	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34889890	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	35751644	Inhibit	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31437234		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	15118294		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	LHGDN	15118294		★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	31004710		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	15118294, 31004710		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	10706506, 12775240, 16319604, 17082651, 18202785, 19101504, 21711965, 21819747, 22185747, 23957339, 28716167, 31576112, 8563931		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	10706506, 27091669, 36304979	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	15515495		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28842563	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11381123, 16139912, 16273277, 17079456, 17320280, 17786271, 18171482, 18588866, 18931081, 19340604, 19360294, 19687742, 21431960, 21560180, 21707863, 21956366, 22952803, 24335623, 24504675, 25347745, 28243126, 28452850, 28635400, 28892580, 29749553, 29785139, 30123088, 30430078, 30608382, 30936832, 31217935, 31442259, 31742692		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	11381123, 18171482, 18570662, 19293812, 20847590, 20964870, 22952803, 24504675, 24877105, 32448862, 33099941, 33875643, 37925811, 39304953	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30151927	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	31786874	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	33545035	Stimulate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	16499871		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	10682677, 10873988, 21199795, 25823012, 29854577, 31688595, 33446784, 8644848	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11115828, 15793304	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	25659996, 30100520, 30213591, 31125264, 31615465		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	25659996, 29068435, 30100520, 30213591, 30527488, 31125264, 31383782, 31615465		★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	17183558	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10023003, 10023341, 10029081, 10048976, 10102229, 10102622, 10211101, 10211121, 10213212, 10215998, 10326959, 10357566, 10361100, 10362127, 10362145, 10365146, 10375015, 10375104, 10383147, 10397264, 10414467, 10416597, 10440683, 10443829, 10449407, 10451490, 10456459, 10457902, 10468067, 10473101, 10475065, 10490819, 10535326, 10541969, 10597197, 10607018, 10611308, 10616207, 10623663, 10629090, 10636104, 10641751, 10646734, 10646866, 10661874, 10675482, 10682677, 10705399, 10738243, 10741908, 10746978, 10751360, 10757022, 10778727, 10779196, 10786681, 10788475, 10822130, 10873080, 10873632, 10880549, 10882357, 10914744, 10923916, 10944227, 10953920, 10969766, 10980868, 10999768, 11020798, 11030151, 11058875, 11074523, 11089881, 11092527, 11102890, 11103779, 11106244, 11114720, 11115562, 11115828, 11156525, 11169955, 11175849, 11176459, 11221852, 11241411, 11280784, 11291072, 11306513, 11326316, 11326319, 11336478, 11358846, 11389060, 11431362, 11435313, 11438469, 11505392, 11507052, 11519827, 11535528, 11551414, 11559575, 11563986, 11568057, 11585776, 11592307, 11678209, 11679938, 11741977, 11745200, 11751516, 11764072, 11772947, 11774032, 11774256, 11774259, 11778648, 11804750, 11806643, 11819727, 11819817, 11839574, 11874628, 11875737, 11880187, 11912163, 11929808, 11929819, 11938453, 11948107, 11948135, 11957147, 11964077, 11980898, 12015752, 12039075, 12058259, 12086877, 12086892, 12114428, 12124351, 12136423, 12142733, 12151344, 12177445, 12177446, 12182416, 12193477, 12193566, 12210089, 12213878, 12234411, 12237899, 12239588, 12298426, 12379772, 12386924, 12388254, 12429648, 12429844, 12429975, 12439912, 12448000, 12460468, 12460925, 12466143, 12474525, 12475675, 12496487, 12499918, 12509854, 12539169, 12553017, 12576459, 12590639, 12629515, 12631072, 12651601, 12684059, 12700666, 12702589, 12715166, 12746434, 12759248, 12767510, 12776187, 12778165, 12782015, 1279431, 1279432, 12808060, 12810638, 12819396, 12821346, 12831059, 12831061, 12853836, 12855650, 12885781, 12888890, 12907650, 12907944, 12918061, 12923562, 12941820, 12941839, 12960698, 12963694, 12971625, 14500375, 14520689, 14525759, 14532971, 14550470, 14556934, 14600590, 14602779, 14605010, 14612518, 14618612, 14627985, 14632212, 14639356, 14639600, 14659975, 14672622, 14690153, 14695189, 14707272, 14710231, 14712314, 14719060, 14719061, 14871830, 14977830, 14981918, 14983012, 14991568, 14991930, 14991937, 15014023, 15015593, 15015599, 15015778, 15018896, 15026321, 15026340, 15034795, 15035285, 15059936, 15087251, 15095259, 15112366, 15118294, 15123463, 15126083, 15130943, 15132834, 15142681, 15150085, 15153787, 15158098, 15170660, 15194048, 15198686, 15205362, 15221009, 15221961, 15274325, 15277193, 15289345, 15289739, 15294883, 15299064, 15307132, 15313899, 15342781, 15450248, 15469392, 15470486, 15475194, 15475935, 15477708, 15490972, 15494123, 1550962, 15517881, 15520188, 15520458, 15531234, 15541813, 15552801, 15561777, 15564138, 15564832, 15582199, 15592500, 15592523, 15605080, 15610528, 15616600, 15633219, 15649325, 15659795, 15663685, 15665307, 15668142, 15671530, 1567395, 15674201, 15701826, 15704107, 15709207, 15739081, 15754342, 15781657, 15790444, 15809749, 15816521, 15816564, 15831913, 15833850, 15845615, 15860260, 15868933, 15871723, 15897235, 15897451, 15897560, 15911882, 15919761, 15928093, 15928654, 15928657, 15930297, 15949234, 15949894, 15958580, 15971170, 15994966, 16002475, 16007214, 16010420, 16034468, 16039163, 16041398, 16103054, 16103069, 16103075, 16116481, 16136500, 16139912, 16160694, 16171822, 16181451, 16193833, 16204726, 16205646, 16210641, 16211223, 16218779, 16230387, 16244591, 16244806, 16254106, 16260429, 16260857, 16267000, 16267616, 16273277, 16305462, 16314637, 16322226, 16322239, 16322245, 16340308, 16343055, 16357523, 16360003, 16391790, 16396768, 16397053, 16432214, 16434990, 16452204, 16467105, 16482630, 16489061, 16489641, 16507411, 16510175, 16513837, 16518831, 16546703, 16551879, 16552754, 16555551, 16563610, 16565972, 16580881, 16596207, 16612574, 16618748, 16622457, 16632420, 16641275, 16641910, 16671089, 16675573, 16682956, 16723121, 16740700, 16754748, 16772349, 16775835, 16788159, 16804907, 16818645, 16826426, 16843105, 16847424, 16847924, 16857775, 16899616, 16899623, 16908180, 16909104, 16918299, 16949904, 16951162, 16954163, 16962197, 16964394, 16966150, 16982753, 16982770, 16985052, 16989774, 16997614, 17006982, 17007042, 17010208, 17024232, 17027148, 17030605, 17034851, 17066424, 17070589, 17079456, 17088992, 17094412, 17108129, 17131319, 17150152, 17164332, 17169602, 17183061, 17183313, 17203773, 17214348, 17214745, 17235306, 17241515, 17244253, 17259446, 17287073, 17319747, 17320280, 17332933, 17334345, 17342330, 17360669, 17369603, 17374440, 17374519, 17409807, 17431116, 17437845, 17440098, 17440100, 17461470, 17471570, 17473188, 17505039, 17511025, 17524506, 17547528, 17549480, 17557905, 17559806, 17564725, 17570036, 17579068, 17595666, 17599955, 17614789, 17615535, 17616938, 17622469, 17628298, 17636117, 17636397, 17639040, 17671719, 17695550, 17704802, 17717144, 17721409, 17727254, 17786271, 17826033, 17855506, 17869204, 17881360, 17881971, 17891237, 17908997, 17914566, 17917967, 17940185, 17964232, 17991428, 18006774, 18048970, 18057715, 18081234, 18086000, 18095884, 18171482, 18172253, 18182107, 18199548, 18202023, 18223238, 18234958, 18240146, 18260092, 18281490, 18283272, 18287363, 18292935, 18310147, 18317076, 18324912, 18339868, 18343725, 18359762, 18381453, 18383582, 18384433, 18392139, 18398429, 18442195, 18450321, 18461364, 18476949, 18483361, 18485799, 18486981, 18494554, 18498284, 18504050, 18504437, 18506998, 18509748, 18537159, 18544566, 18546269, 18549879, 18559522, 18568347, 18596272, 18629779, 18630531, 18645275, 18701503, 18713470, 18726892, 18774636, 18780893, 18825410, 18836566, 18845354, 18852147, 18924243, 18925694, 18991494, 19002496, 19014781, 19017755, 19018001, 19058305, 19074872, 19080330, 19089921, 19115205, 19116006, 19116756, 19131542, 19152448, 19162240, 19172414, 19190516, 19208748, 19223371, 19228721, 19242105, 19246638, 19249018, 19253105, 19260835, 19292890, 19320940, 19324447, 19340614, 19360294, 19366059, 19398483, 19401451, 19431143, 19437022, 19440651, 19443352, 19447865, 19452941, 19481369, 19495772, 19496189, 19498005, 19520294, 19541645, 19548138, 19567589, 19576799, 19596413, 19596939, 19617539, 19624457, 19652095, 19653712, 19663667, 19706811, 19713740, 19724908, 19755510, 19755511, 19755989, 19765808, 19779139, 19824060, 19825192, 19825989, 19837976, 19887629, 19908168, 19913908, 19955413, 19965691, 20015323, 20038817, 20039326, 20042679, 20043959, 20047302, 20052595, 20056267, 20060810, 20066901, 20098841, 20103650, 20112275, 20117921, 20140208, 20141840, 20155508, 20173740, 20175032, 20179233, 20187794, 20187798, 20191032, 20194016, 20194889, 20197469, 20200565, 20205165, 20208480, 20210523, 20225197, 20232090, 20307196, 20308559, 20354907, 20363046, 20367336, 20398289, 20406100, 20414936, 20420713, 20454519, 20463761, 20470445, 20484434, 20501856, 20504328, 20570889, 20593288, 20594200, 20594639, 20628392, 20660740, 20665500, 20673348, 20697987, 20704656, 20705559, 20738252, 20818432, 20830515, 20838385, 20856806, 20864511, 20883786, 20927318, 20927579, 20937881, 20941554, 20948320, 20950431, 20952691, 20956946, 21041183, 21041381, 21057538, 21070749, 21080911, 21093415, 21098094, 21102424, 21102433, 21107877, 21109935, 21116837, 21146939, 21152298, 21163514, 21204766, 21209070, 21212415, 21220497, 21220916, 21236475, 21278237, 21283766, 21283904, 21333376, 21343372, 21343374, 21351097, 21378364, 21389833, 21427706, 21439312, 21447743, 21458987, 21465641, 21483741, 21491998, 21495021, 21504321, 21538854, 21546870, 21551262, 21552147, 21559457, 21561598, 21567098, 21593792, 21600232, 21605611, 21610170, 21618540, 21624769, 21636578, 21669154, 21702037, 21713446, 21728393, 21737454, 21743435, 21766497, 21785819, 21791631, 21842119, 21853126, 21858763, 21893035, 21912636, 21917858, 21920991, 21955618, 21957028, 21979892, 21989163, 22009797, 22066783, 22082308, 22085359, 22118052, 22125026, 22156924, 22170854, 22171127, 22172722, 22183643, 22189627, 22198428, 22200682, 22210436, 22231433, 22231565, 22247010, 22258871, 22262122, 22273580, 22291136, 22300081, 22300949, 22315135, 22321154, 22321253, 22370635, 22372503, 22384017, 22392726, 22393126, 22406998, 22426337, 22472177, 22498007, 22524830, 22549391, 22576211, 22580114, 22613408, 22618716, 22626276, 22640261, 22664115, 22673390, 22684860, 22693250, 22718841, 22735808, 22761861, 22786655, 22789825, 22806981, 22808003, 22815044, 22824793, 22842937, 22844419, 22872519, 22872931, 22882209, 22890617, 22901144, 22901561, 22992293, 22992725, 22993299, 23019013, 23019156, 23025904, 23031678, 23036194, 23045606, 23064377, 23076130, 23076131, 23092556, 23104276, 23123638, 23132371, 23155226, 23161568, 23164421, 23167360, 23175214, 23185544, 23185615, 23201159, 23202914, 23204132, 23212515, 23219526, 23224595, 23226093, 23241508, 23242200, 23243026, 23267058, 23269798, 23288726, 23326384, 23340303, 23361277, 23382046, 23393196, 23398358, 23401453, 23404510, 23408993, 23436775, 23441128, 23459872, 23462173, 23528211, 23529839, 23536895, 23546515, 23548264, 23573305, 23584483, 23608225, 23613251, 23625175, 23633492, 23635653, 23651727, 23679262, 23685835, 23686836, 23712501, 23716000, 23729266, 23731250, 23748663, 23764725, 23766646, 23794399, 23802567, 23820929, 23832257, 23840389, 23851383, 23858102, 23902770, 23904001, 23907365, 23908593, 23908598, 23950958, 23959576, 24009521, 24029605, 24030704, 24033329, 24114200, 24126726, 24129092, 24146275, 24166904, 24185122, 24194900, 24194905, 24203759, 24206208, 24236050, 24260373, 24272355, 24320134, 24324963, 24366206, 24373788, 24374745, 24389815, 24390398, 24401755, 24401996, 24421272, 24442130, 24474587, 24491031, 24509158, 24510746, 24510818, 24520215, 24528036, 24561231, 24568488, 24577128, 24613049, 24614362, 24615579, 24625025, 24628278, 24632756, 24638982, 24659637, 24670538, 24680191, 24687604, 24714932, 24727985, 24730523, 24737201, 24754736, 24755544, 24778130, 24781871, 24805287, 24815448, 24817013, 24833243, 24875759, 24894645, 24895598, 24898870, 24914051, 24926530, 24962367, 24972565, 24975163, 24980036, 24989926, 24995304, 25010863, 25017943, 25039617, 25061734, 25068796, 25076849, 25086956, 25100134, 25117311, 25117980, 25135429, 25143028, 25147179, 25152223, 25154789, 25156870, 25162518, 25175315, 25192722, 25202080, 25204429, 25218456, 25222223, 25277774, 25278704, 25301403, 25310734, 25310988, 25320277, 25326806, 25330803, 25333354, 25351816, 25353068, 25379634, 25382637, 25497868, 25500545, 25538263, 25571952, 25572536, 25577246, 25577253, 25592040, 25615717, 25619833, 25622528, 25644713, 25672594, 25672981, 25682871, 25692652, 25724086, 25735814, 25738867, 25769726, 25778315, 25787299, 25792473, 25794107, 25804797, 25824321, 25845525, 25860662, 25862879, 25867067, 25867272, 25880726, 25885889, 25889301, 25932951, 25941985, 25944623, 25948774, 25955218, 25962155, 25972323, 25976379, 25990504, 26044849, 26058869, 26067906, 26099723, 26139353, 26159278, 26160610, 26166416, 26169213, 26179332, 26232913, 26244545, 26254223, 26261495, 26278330, 26295809, 26304926, 26310563, 26356851, 26369495, 26398444, 26404753, 26408256, 26416452, 26416897, 26476432, 26484606, 26526574, 26554033, 26580599, 26588727, 26611645, 26625311, 26631613, 26645582, 26666821, 26716512, 26716898, 26725326, 26756933, 26761211, 26775675, 26777415, 26791086, 26805636, 26848522, 26861159, 26909925, 26911405, 26919112, 26967562, 26995061, 26996193, 27033458, 27050277, 27064283, 27067785, 27074576, 27116183, 27127303, 27173353, 27195611, 27223086, 27230280, 27253180, 27270432, 27280289, 27286448, 27302189, 27322147, 27325687, 27345398, 27352182, 27387303, 27428264, 27440271, 27444986, 27452367, 27466356, 27520561, 27568980, 27572288, 27573078, 27574422, 27575851, 27602495, 27602496, 27669225, 27699512, 27723576, 27740975, 27757723, 27775991, 27784207, 27793775, 27821803, 27826041, 27830379, 27836247, 27838496, 27844272, 27863212, 27872951, 27897101, 27930983, 27934882, 27977771, 27980109, 27986626, 27988457, 27992500, 27998883, 27999187, 28003187, 28008154, 28034921, 28043912, 28052202, 28056756, 28059647, 28082399, 28092822, 28094316, 28110235, 28114283, 28119364, 28122267, 28123567, 28127049, 28134312, 28141797, 28147320, 28152577, 28162277, 28162910, 28163656, 28174788, 28176920, 28178994, 28179359, 28186102, 28190652, 28191845, 28205552, 28209239, 28212293, 28215534, 28221861, 28243126, 28256615, 28259903, 28259965, 28260607, 28268243, 28274247, 28274796, 28282869, 28284729, 28288569, 28298545, 28301874, 28317244, 28322833, 28338654, 28342098, 28345657, 28346429, 28359197, 28362978, 28367666, 28379574, 28402934, 28403223, 28404865, 28416384, 28417956, 28418194, 28419967, 28432289, 28435293, 28439752, 28445154, 28455419, 28459196, 28466607, 28469969, 28498441, 28509606, 28511963, 28523303, 28529585, 28530155, 28533682, 28545581, 28557832, 28558368, 28560583, 28587437, 28591697, 28592123, 28594929, 28602979, 28615679, 28627678, 28633995, 28643744, 28651835, 28652734, 28655794, 28655889, 28656083, 28656256, 28660986, 28666098, 28679123, 28682138, 28691414, 28693887, 28704054, 28711021, 28714017, 28720900, 28730780, 28740548, 28742793, 28749108, 28756150, 28764703, 28765707, 28779210, 28780387, 28790461, 28791360, 28791841, 28814880, 28822888, 28823674, 28830617, 28841975, 28853613, 28860767, 28861154, 28863382, 28876084, 28885396, 28894229, 28903354, 28911884, 28916756, 28927050, 28929822, 28938160, 28938163, 28942831, 28948650, 28978924, 28985230, 28985606, 28987998, 28994107, 29032404, 29035831, 29059426, 29067649, 29069797, 29077165, 29096753, 29100366, 29107835, 29113405, 29115583, 29118335, 29133593, 29149180, 29149434, 29150606, 29162879, 29179185, 29187438, 29190920, 29192324, 29196964, 29210417, 29215754, 29220293, 29228574, 29239327, 29248713, 29257333, 29258180, 29262608, 29267273, 29268703, 29276417, 29279095, 29297707, 29298682, 29307241, 29312351, 29317493, 29345296, 29346400, 29357089, 29357916, 29362508, 29366307, 29390928, 29393472, 29396728, 29416753, 29420334, 29434942, 29437915, 29449267, 29461122, 29461590, 29474747, 29508855, 29512738, 29514082, 29517106, 29519923, 29523110, 29532562, 29535383, 29563634, 29567938, 29603739, 29609579, 29617404, 29617556, 29623256, 29631257, 29644004, 29649432, 29649635, 29652061, 29654110, 29655782, 29660229, 29669735, 29693146, 29693703, 29695634, 29700053, 29707135, 29712569, 29719394, 29730399, 29730556, 29733658, 29740494, 29747600, 29749455, 29755400, 29774068, 29787601, 29807443, 29808997, 29845206, 29874097, 29885559, 29888133, 29892930, 29904424, 29904944, 29914006, 29917189, 29917190, 29926253, 29928412, 29928441, 29940258, 29948886, 29952957, 29957061, 29959593, 29960070, 29970684, 29981460, 29983872, 29985074, 29997451, 30008907, 30010108, 30017791, 30024080, 30044907, 30048250, 30050305, 30053447, 30062604, 30062609, 30065361, 30066848, 30067113, 30070704, 30087142, 30091943, 30092405, 30093597, 30104711, 30116312, 30116337, 30132576, 30135425, 30136881, 30144476, 30150039, 30160184, 30165233, 30170190, 30178447, 30183516, 30194214, 30198403, 30206412, 30210550, 30214582, 30228246, 30228780, 30241030, 30272364, 30280196, 30283071, 30292065, 30293733, 30294773, 30315890, 30324091, 30325072, 30327408, 30336465, 30336549, 30339905, 30345740, 30372397, 30396964, 30397360, 30405103, 30405819, 30410348, 30411685, 30412123, 30412628, 30420976, 30423986, 30439360, 30472294, 30477221, 30479372, 30483120, 30499350, 30499413, 30504718, 30511933, 30520543, 30529768, 30544959, 30551529, 30555255, 30564299, 30569877, 30574871, 30596551, 30600870, 30605014, 30608382, 30613298, 30633508, 30636586, 30639585, 30662269, 30675255, 30675307, 30682194, 30689555, 30698737, 30704052, 30723144, 30740671, 30755242, 30789971, 30805775, 30833190, 30837171, 30838843, 30854051, 30862805, 30863089, 30880778, 30896867, 30900382, 30911540, 30914029, 30920845, 30930215, 30935077, 30941953, 30944079, 30952738, 30972888, 30975732, 30984553, 30985194, 31012354, 31018946, 31023336, 31066091, 31081057, 31082770, 31096306, 31121490, 31148871, 31152080, 31156623, 31169331, 31177125, 31186706, 31187795, 31189369, 31217935, 31254108, 31258881, 31268155, 31284875, 31285776, 31297348, 31301309, 31314153, 31344426, 31356114, 31364793, 31368127, 31381135, 31394786, 31401722, 31402291, 31403867, 31417656, 31471713, 31496820, 31496821, 31501519, 31514445, 31524253, 31547581, 31550560, 31560359, 31564024, 31564192, 31564967, 31572184, 31594707, 31597643, 31598338, 31601958, 31611984, 31617074, 31617075, 31635541, 31653130, 31678422, 31695774, 31696949, 31704735, 31713115, 31715423, 31717527, 31719927, 31740486, 31752390, 31770191, 31773940, 31778831, 31816265, 31824854, 31825830, 31829270, 31848332, 31848994, 7525053, 7525492, 7528359, 7533661, 7535799, 7688963, 7707437, 7784058, 7846687, 8380810, 8527839, 8548760, 8554590, 8558848, 8589021, 8617424, 8619189, 8626126, 8644861, 8667614, 8690516, 8710899, 8756616, 8757194, 8806195, 8855222, 8930020, 8930647, 8994354, 9023368, 9067270, 9203508, 9255258, 9255609, 9261311, 9284816, 9307273, 9346879, 9422768, 9488306, 9507532, 9520413, 9592205, 9607631, 9635853, 9646228, 9657098, 9671758, 9683299, 9713587, 9724788, 9751633, 9777955, 9777956, 9788618, 9815567, 9815813, 9815846, 9823778, 9828211, 9828838, 9846573, 9846989, 9848101, 9863024, 9872603, 9916127, 9917513		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	18494554		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	27325687		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	16395752		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	12177446, 18631392, 21910893, 25422204, 30530043		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	LHGDN	12883692		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	24616092		★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	11744811		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	19225555	Inhibit	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	21978756, 24213003	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	8910928		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	10073603, 11744811, 14551356		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	34873575, 35837376	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	31531336		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	30719863, 36820574	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	17083617, 19493574, 23475071, 25887968, 28492549, 28911884, 29342116, 31250275		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	9787178		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	11426493	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	17570036, 18679811, 21647202, 28440459, 28911884, 31848332		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	17570036		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10815914, 11768614, 11815985, 11912515, 12115498, 12177446, 12483647, 12632379, 14605672, 15064733, 15126083, 15882878, 15927358, 15930297, 16193833, 16618748, 16731852, 17088992, 17097563, 17383815, 18278068, 18384433, 18645007, 18790743, 19412427, 19423615, 19661350, 20179233, 20186105, 20331634, 20662003, 21484514, 21750048, 21829174, 22564723, 22804730, 24439602, 24815448, 25288151, 25616966, 25648303, 25889839, 26084291, 26788968, 26986724, 27669225, 28111925, 28259965, 28715613, 28894229, 29948886, 30712809, 30877107, 31524279		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11815985, 18278068, 19540207, 19895696, 20179233, 23155231, 24439602, 24815448, 25292042, 28111925, 28259965, 32295184, 32336043	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17088992, 19661350	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21573104, 31332262	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25751166	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	14702101, 15177192, 15732116, 16154235, 16784838, 16856151, 19272614, 20430437, 21334418, 21573104, 23475071, 28570669, 29527475, 29982985, 30341696, 31332262, 31615077		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	16784838		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31219430, 31671489		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	27764830		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	27764830		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	12845630, 19212638, 21095547, 21622725, 23391109, 26087898, 27082107, 29853660, 30768575		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	12403556, 18679811, 23528211		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	12403556, 23528211		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	17570036, 26369495, 28429859, 28911884, 31848332		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	20686603, 25833823	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10218880, 19796028, 20352346, 20565248, 28662688, 29034435, 29739345, 30719863, 31167931		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	28343620		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	20940716	Associate	★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	29620141		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	25417698, 29397865		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	17383815		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	15191350, 18647955		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	18630688		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	28178662		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	22658783, 26845596, 30096951, 31044438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10373662, 10499626, 11092527, 11102890, 11208836, 11461086, 11720743, 11778648, 11844810, 12845630, 14981918, 15364135, 15541813, 15704107, 16103075, 16125276, 16314637, 16459176, 16513206, 16530326, 16934908, 17027148, 17079777, 17167724, 17505039, 17599955, 17868952, 17912235, 18223238, 18281657, 18317076, 18594312, 19152186, 19157636, 19324448, 19594543, 19596939, 19662677, 19885594, 20187798, 20395213, 20400478, 20439190, 20540786, 20628392, 20712888, 21120482, 21333372, 21461966, 21565488, 21724587, 21854359, 22275507, 22320189, 22494932, 22541966, 22819774, 22992329, 22992725, 23064377, 23371029, 23459872, 23584298, 23591990, 23695169, 23756092, 23774791, 23781133, 24192124, 24367507, 24577128, 24628278, 24659637, 24691828, 24793809, 25001183, 25058399, 25162518, 25272226, 25410981, 25430449, 25504327, 25524578, 25598052, 25672981, 25773840, 25889301, 26134224, 26179332, 26336994, 26479311, 26485685, 26537995, 26542886, 26662393, 26817645, 26884885, 26931433, 26950275, 27392029, 27690345, 27709850, 27940520, 28100078, 28131635, 28150169, 28176920, 28259903, 28591698, 28627678, 28693213, 29025597, 29049797, 29088109, 29108350, 29108922, 29434942, 29438092, 29515799, 29537214, 29675110, 29693703, 29760791, 29783929, 29910647, 30037363, 30112043, 30233875, 30429024, 30635009, 30854085, 30915273, 30988808, 31090020, 31092048, 31169681, 31205560, 31352324, 31421224, 31497360, 31534526, 31591063, 31611984, 31741764, 31764022, 31829270, 31841190, 9815567, 9815760, 9863024, 9918214		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	15956251		★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	28431433		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	14674989, 15871723, 16807982, 21865136, 7821921, 9366297, 9828838		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	15871723		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29772306, 29968119, 30310054		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	26502822, 29488610		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	14988276, 15613686, 18728224, 20101248, 21612402, 23303012, 24812430, 27834039, 28223936, 28725215, 28798202, 29113405, 29115082, 29244802, 29721017, 29874563, 30398903, 30597763, 31258484, 31552486		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19074987, 20057362, 21203453, 23303012, 25116954, 27015185, 29115082, 32160900, 34429108, 35090332, 37047308, 37219669, 37878496	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20430377, 23935253, 27677832	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29784904	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	34048505	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	28358961		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	11943725	Associate	★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	11896820		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	15736439, 29970508		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	28469969, 9669344		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	37946484	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30927279		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21418620	Stimulate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21989653	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	37157945	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	39261828	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	28619073, 31049005		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	23155356, 39287165	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15731292, 17187682, 23935253, 25341039, 26090403, 27989872, 30186872, 34502489, 38203564	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	16732616, 19890996, 20060952, 20581375, 23671648, 26996575, 27916780, 31467907, 31662989, 32131466, 32572904, 33853636, 33953899, 36314121, 36769248, 36781858, 36960385, 37140355, 37548663, 37652257, 38090564, 39738612	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	29258882	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	36769248, 38200556	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	24297611, 26996575, 29945585, 31662989, 34983993, 36314121, 36529415, 39354436	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	24757145, 29402254		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	18597093, 24966080, 28810626, 29945585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	21963742	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	CTD_human_DG	24235232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29752623, 30038058, 30317635		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	29328414	Associate	★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	16609965, 19763724, 22287106, 25820558	Associate	★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	10432291		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23500833, 28238166, 29518117, 31678741, 31821593		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29518117, 31747953, 33499313, 36147560, 36626454	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32427128	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	19394248, 30735778		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15985268, 17310851, 17549480, 17892509, 18339860, 18473395, 18636145, 19409047, 19642105, 21495021, 22274866, 22472569, 23202914, 23219526, 23430952, 23666471, 23907576, 24114200, 24310504, 24330824, 24759089, 25330803, 25337211, 25385479, 25550863, 25860662, 25966208, 26062523, 26077139, 26345754, 26400284, 26600515, 26713602, 26759259, 26783521, 27144378, 27351225, 27352347, 27777493, 28406476, 28619014, 28631382, 28632184, 28647210, 28656259, 28702842, 28736978, 28938163, 28977834, 29257309, 29474747, 30235774, 30280196, 30542722, 30566604, 30890367, 30988774, 31169001, 31180533, 31262893, 31448053, 31484533, 31676993, 31719210, 8992878		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	16528367, 18438338, 18528739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	16528367, 18528739, 19670450, 20158913, 21495021, 22472569, 22855059, 23015149, 23740448, 24310504, 24330824, 25337211, 25418192, 25550863, 25966208, 26345754, 26400284, 26600515, 28619014, 28631382, 29474747, 30229817, 30566604, 31175097, 31322006, 31484533, 31571500, 31676993, 32665038, 33015767, 33112560, 33321940, 35695550, 36618348, 38086608	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	20158913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	27777493, 39768988	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosclerosis	Osteosclerosis	BEFREE	14871830		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	10687938		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	10687938, 30919059		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10901370, 11804750, 12466143, 12529984, 12874030, 14719060, 15897235, 17010410, 17717144, 25577253, 7707437		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	LHGDN	18037256		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	18053993	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	12095505, 23749764	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	15193472, 15337760, 18053993, 23029477, 32619126, 33277847, 37883761, 38037065	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30683144, 31034039		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	12107240, 14614207, 15155606, 18164141, 18166186, 19573286, 21082502, 21269615, 22549715, 22587628, 24851136, 26308290, 27032713, 27555316, 28350328, 28403961, 28635413, 28676533, 28683759, 28820403, 29880170, 31004220, 31122524, 31133458, 31167229, 31329230, 31472696, 7775647		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	21269615, 22587628, 24603682, 24851136, 29843716, 31996061, 32152452, 32945993	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	28820403	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	32152452	Stimulate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10901370, 11774259, 11839574, 12114428, 12668280, 12684660, 12810677, 15087251, 15213310, 15897235, 16152587, 16211223, 16886597, 17289129, 17289883, 17419711, 17498666, 17559911, 17717144, 18182107, 18337445, 19253105, 19509553, 19775995, 20130421, 20832104, 21041183, 22210436, 22579791, 22700681, 23254909, 24075030, 24141405, 24236050, 24761768, 24815691, 25176450, 25296882, 25374251, 25637316, 25835351, 25990504, 26531153, 26610586, 27064283, 27401249, 27483433, 27498762, 27852039, 27943222, 28008951, 28179359, 28289938, 28301874, 29048687, 29069849, 29075785, 29218693, 29721047, 29904943, 30066848, 30093968, 30348916, 31200683, 31639291, 8667614, 9777956		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12615701, 12684660, 15474452, 16152587, 16515588, 16835828, 17289883, 18075302, 18337445, 18483368		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10901370, 11487257, 11641398, 12023962, 14534882, 15274387, 15347673, 17419711, 18075302, 18337445, 18376140, 19010874, 19028702, 19147754, 19253105, 20334653, 20599538, 20797318, 21041183, 21521830, 22270366, 22957340, 22990536, 23029477, 23169339, 23174937, 23437196, 23464458, 23527953, 23652833, 23965899, 24236050, 24761768, 24815691, 24921663, 25192722, 25885889, 26158818, 26530725, 26868378, 27438831, 28179359, 28289938, 28678326, 29308068, 29770329, 29955134, 30843637, 33277847, 34238029, 34268922, 34577856, 34783299, 35538489, 36757936, 36758419, 36862865, 39608974, 9365173	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11071270, 14606105, 15337760, 20177148, 24374756	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25374251, 32727400	Inhibit	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	12111694, 16831481, 17108129, 23635653, 24050874, 28259690, 31679299		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	19799610, 21528000, 27732900, 28660411		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10457902, 11291072, 11358838, 11505392, 12136423, 12298426, 12370751, 12499918, 12545153, 12553038, 14604996, 14639356, 15026340, 15374992, 15674201, 16109537, 16482630, 16525644, 16807445, 16885366, 17145834, 17356708, 18307536, 18350635, 18665180, 19080330, 19152448, 19208748, 19437103, 19908168, 20023433, 20118543, 20482858, 20927318, 21382954, 21408027, 21728393, 21729304, 21737511, 21885862, 22016776, 22084065, 22207048, 22472348, 22580114, 22906006, 23254994, 23467576, 23719599, 23729403, 23745588, 23924856, 27426724, 27986626, 28338114, 28916756, 28943931, 29963167, 30027561, 30091943, 30333153, 30861616, 30914029, 31087222, 31638231, 9815813		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	33387563, 34166836	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	25875799		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	11291072, 12142733, 18026817, 24975163, 26261495, 26804176, 28984028		★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	21095547		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11291072, 16046552, 21224502, 22066783, 24509158, 26995061, 28916756		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12545153, 12553038, 12937141, 14604996, 16163059, 18307536, 18350635, 18665074		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10188906, 12298426, 12937141, 14604996, 14760765, 15476280, 15558070, 15952180, 16482630, 16532435, 17568185, 17968710, 18307536, 19575490, 20354770, 20367641, 21224502, 21263190, 21729304, 22393285, 22731825, 22805328, 23272057, 23651239, 23764046, 23992308, 24002598, 24341512, 25176061, 25550789, 27941651, 28338114, 29157747, 30397360, 30551529, 30861616, 31044775, 32463297, 33760162, 34274912, 34629822, 34658294, 35222383, 36272973, 36743929	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	9665487	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	16488441		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	20495748, 21655646, 28730233	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31176170		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	20495748	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	15917409, 21224502, 31087222, 9888665		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	26052049, 27116183, 27989785, 28974261		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16260429, 16712675, 16772349, 17891237, 21093207, 21385081, 24670538, 24884830, 27704649, 27925342, 28178662, 29563812, 29593418, 30076136, 30843635		★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	27930460		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	26662142	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30718984, 9833779		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	10646734, 18039096, 21422080, 22183643, 28264974		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	32771066	Inhibit	★☆☆☆☆ Found in Text Mining only
Parasagittal Meningioma	Parasagittal Meningioma	BEFREE	31653130		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	14570746		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15066146, 18359110, 21107440, 21152280, 21334418, 21771855, 23695225, 27481110, 28025049, 28569795, 30041526		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21407216, 33504893, 34660782, 37834363	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	22382585, 24189015, 25533682	Stimulate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	11849398, 21771176, 25384022		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	39412903	Stimulate	★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	21315342	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	18026817, 21691249, 26804176, 30333153		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	21612402, 27015185		★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	33880547	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	7738351	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	8702976	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	27510449, 29489039		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	29489039		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	18806258	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	19120886, 19496079		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	31419595		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	12666706, 17279364, 17760549		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	20127137, 31001696, 31020669		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	27058371, 39337647	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11453114, 12558942, 16846342, 20127137, 23592000, 31020669, 31174446, 31588098, 31707108		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25861162, 27058371, 37749912	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	16443741	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	20382861, 22064697, 24657063, 30104096	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	24157526	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	11502697, 12499610, 12586226, 12718732, 12796772, 14504183, 15365252, 15680969, 16443741, 19340019, 22064697, 22470498, 22762535, 23856679, 24157526, 24657063, 25362254, 27974423, 28220078, 28821752, 29618157, 29687324, 29689451, 30200778, 30586702, 31564130, 8727509		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	12718732, 15365252, 19340019, 22762535, 23856679, 29687324, 30586702		★☆☆☆☆ Found in Text Mining only
Peripheral Nerve Sheath Neoplasm	Peripheral Nerve Sheath Neoplasm	BEFREE	18679811		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28662688, 31167931, 31499478		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	28662688, 35069435	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28662688, 31167931, 31499478		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28053548, 31516591		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	11502697, 11728604, 12349828, 12499610, 12586226, 12796772, 14504183, 15153644, 15680969, 15778409, 16075056, 29687324, 8989106		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	19889554	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	25384022, 28601126, 28791669, 28978530, 29363326, 30598338		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	25384022, 25636412	Stimulate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	9527324	Stimulate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	17094412, 18200665, 21089052	Stimulate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	21540863, 22808003, 23585849, 26873137	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	11605159, 12780519, 14659975, 19017755, 22183643, 23106811, 28264974, 28423608		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	11605159, 23106811, 24675699, 25973039	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	12368197	Stimulate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	15544519, 17259494, 17481772, 17560613, 17849138, 18682813, 18709380, 20057509, 20444917, 20591524, 21309690, 21757152, 23092969, 23213275, 23434931, 25217793, 25468312, 25956512, 26648523, 26720478, 27120595, 27531356, 27830398, 27860331, 27886182, 28241308, 28271611, 28272719, 28391660, 28456825, 28571008, 28572674, 28654984, 28680705, 28905243, 28947815, 29098793, 29246890, 29621508, 29853773, 30043039, 30144414, 30380554, 30579324, 30706803, 30900812, 30980286, 31019585, 31318490, 31378876, 31403827, 31421026, 31422516, 31439644, 31574534, 31612255, 31741855, 31772768, 9245719		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	20704656, 21458987, 31408921, 9255258		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	25027022, 30639490		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30210447		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	12213878, 12590639, 15453394, 16226108		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	12590639		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25027022, 28660986, 34620658, 35833823	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	BEFREE	17044926		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	11404254, 15492846, 22431315, 23053181, 25425729, 25635424, 28626164, 28927127		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	LHGDN	12187074, 15492846		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	21451433		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	21451433		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	29380239		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	12872442		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	19060482, 22990303, 26909926		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	12759245, 17953946, 20477880, 25106940, 27425379, 27651218, 27766947, 27846231, 27965400, 28300464, 28350328, 28911368, 29115598, 29859385, 30935253, 30963410, 30969784, 31032699, 31298309, 31327131, 31385237		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	12759245, 17953946, 20430377, 25106940, 27766947, 27846231, 28300464, 29206944, 30935253, 31032699, 31327131, 33094626, 34148561, 34360981, 34480296, 35032287, 35766692, 35872929	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	15653207, 17953946		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25141961, 27766947, 34646235, 7531945	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	16769575		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19466975, 20473593, 21217153, 24463275		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24463275, 34206393	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	18821695		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	18821695, 30142763	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	29216907, 30142763		★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	34744103	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	17522146, 30279213, 31371568		★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	LHGDN	18922344		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	CTD_human_DG	18416461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Portal Hypertension	Portal Hypertension	BEFREE	22574900, 24390792, 24503129, 26627607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	31490422, 31790004		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	29271478		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	30350123		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	19707156, 23499421		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18829111		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28550041, 30896872		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31037585		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	15732116		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	17671709		★☆☆☆☆ Found in Text Mining only
Primary Hypothyroidism	Hypothyroidism	BEFREE	29044016		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	BEFREE	21710499, 7528359		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	15613104		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	17442379, 21217153, 22081434		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	26031756, 31653009		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	20413880		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	16411064, 17287403, 28110235, 28163656		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	10845581, 14988276, 15544519, 16046581, 16193288, 17259494, 17481772, 17560613, 18434853, 18441306, 18633446, 18682813, 18709380, 18834676, 20047772, 20220056, 20444917, 21309690, 21757152, 23092969, 23213275, 25274272, 25956512, 26648523, 26720478, 27120595, 27830398, 27860331, 27886182, 27928876, 28098727, 28149790, 28241308, 28271611, 28272719, 28382439, 28391660, 28456825, 28654984, 28740073, 28832635, 28973045, 29049996, 29098793, 29190236, 29203232, 29853773, 30077614, 30144414, 30377995, 30380554, 30579324, 30980286, 31028725, 31378876, 31408201, 31421026, 31612255, 31766241, 31772768, 31802372, 31814880, 7980139, 9245719		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	15988409, 24227910, 28572674, 29461171, 30013318, 31659187		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	29095436	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10893635, 10953325, 11074523, 11176459, 11519827, 12039075, 12067976, 12168088, 12445237, 12496487, 12840218, 12893367, 14744778, 14871830, 15150085, 15161648, 15616600, 15640157, 15701844, 15905202, 15956982, 16193288, 16267000, 16322239, 16530725, 16563610, 16568082, 16606632, 16638750, 16678800, 16740695, 16740700, 16826426, 16908180, 17127464, 17142033, 17216542, 17237281, 17278099, 17310988, 17409440, 17547528, 17914566, 17917789, 18240292, 18398039, 18514506, 18612129, 19089921, 19106642, 19242850, 19495772, 19903767, 19908237, 19923922, 20096741, 20519274, 20564320, 21306303, 21343372, 21427164, 21555367, 21965736, 22105769, 22549243, 22705563, 22777769, 22815235, 22850906, 22855159, 22952749, 23185615, 23359392, 23369005, 23384557, 23831623, 24005860, 24066029, 24127038, 24177231, 24240584, 24353087, 24435801, 24787994, 24858271, 24865426, 25446255, 25586350, 25724697, 26868935, 26995304, 27322147, 27448695, 27527525, 27669423, 27982754, 28143503, 28225015, 28241827, 28259690, 28277613, 28335793, 28387458, 28394264, 28720900, 28974155, 29268703, 29315957, 29362508, 29371637, 29380900, 29391897, 29441606, 29563805, 29707793, 29781343, 29969844, 30053596, 30059715, 30178447, 30186533, 30367880, 30402678, 30459931, 30989489, 31177128, 31383249, 31387585, 31600936, 31649488, 31667686, 31679299, 9067270		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Adenoma	Prostatic Adenoma	BEFREE	11074523		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	15113042	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	15621731, 16820871		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	29563805		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10754495, 12496487, 15500293, 16530725, 17142033, 17278099, 18612129, 19152342, 22469593, 23673480, 27322147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11506499, 11571633, 12401798, 15274358, 15500293, 16491267, 16572586, 16638750, 16886625, 17127464, 17698375, 17908652, 18563715, 18615482, 19106642, 19330806, 19855435, 19908237, 20085644, 20385358, 20537156, 21545229, 22390300, 22546016, 22705563, 23286446, 23369005, 23384557, 23591596, 23625598, 23831623, 23860526, 24066029, 24240584, 24727373, 25272043, 25372421, 26160610, 26341082, 26461474, 26944325, 27448695, 27527525, 27669423, 28510269, 30138363, 30186533, 30989489, 31600936, 32070055, 32198489, 32522441, 32999046, 34399719, 35163369, 35302608, 35328346, 35456461, 35703345, 35849143, 38087324, 8826857	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12039075, 12168088, 12839933, 12893367, 15500293, 15701844, 15905202, 16007189, 16278385, 16820871, 16826426, 17549360, 18240292, 18437586, 18486981, 18615482, 19089921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12893367, 16606632, 16908180, 20052738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22549243, 23679318	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	19811770		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	15140761, 25047123, 26274923	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	15610240	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	19139726	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	19799610, 21528000, 27732900, 28660411		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	26990742		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	19483196, 25264593, 28486967		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	Pubtator	25264593	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10886501, 14962110, 16385345, 16630077, 17543159, 18937791, 19659863, 20160089, 20527041, 22176586, 23870655, 24330353, 24453242, 24587411, 24678886, 25227750, 25384035, 26600499, 26966180, 28110689, 28156019, 28238185, 28803785, 28928080, 28982338, 29193791, 29364440, 29489039, 29579411, 29843550, 30146751, 30942529, 31148856, 31148871, 31384319, 31545526, 7738351, 8064230		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	11348459, 24587411	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	16385345, 17543159, 18054203, 18094729, 18419602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	16385345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	32411787, 33416099, 37531036, 7738351, 8064230, 8702976, 9539788	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	29772306, 29968119, 30310054		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	30310054	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic episodes	Psychosis	BEFREE	29677618		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	12605268, 15885787, 18203080, 18434853, 19288018, 19481369, 20198298, 22219642, 22801834, 22975656, 24123908, 27473792, 28614154, 28686975, 28803935, 28873177, 29178848, 29285278, 29862178, 30821336, 31780873		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17510598, 28120560, 29859904, 30974023, 31190319, 31191356		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18355767, 28120560	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15681497, 30154415	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17136983, 17693481, 19165499, 19196819, 21306579, 23148928, 26251585, 26926362, 27163696, 28298222, 28865600, 28880936, 32158203, 34081380, 34946296	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21660298, 22172637, 26453303	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	11471568, 19327291	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	19144048, 26436397, 36230894	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11254533, 12615615, 15802335, 16361360, 17406066, 17510598, 17968307, 18300052, 18441093, 19136576, 20429787, 20801891, 24155658, 25017817, 28648907, 30053962, 30193865, 30291890, 31191356		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17579094, 19381013, 25843005, 25919965, 26022899, 28661183, 28814671, 29283216, 30272257		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	28128990, 37344825	Associate	★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	16385345		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	20636397, 21658319	Stimulate	★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud Disease	BEFREE	28281457		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	28281457		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	11875737, 17241515, 20117921, 21558395, 23132736, 23794399, 27184911, 29963141, 31261557, 31427042		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	16222693		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	23673188		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	16396768		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	16396768		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	16396768		★☆☆☆☆ Found in Text Mining only
Renal Artery Stenosis	Renal Artery Stenosis	BEFREE	30107490		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18799497, 19402056, 20554520, 20723915, 20973793, 21491998, 21886838, 27395374, 28166200, 28479237, 29371637, 29554654, 29942264		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10211101, 10365146, 10449407, 10475065, 10669954, 11089881, 11301389, 11764385, 11846206, 11875741, 12115316, 12124351, 12597245, 12631072, 12820432, 12853836, 14744756, 15102658, 15474339, 15489000, 15534359, 15569051, 15611513, 15793222, 15964822, 16170373, 16210641, 16507216, 16644575, 16804907, 16827904, 16920734, 17206887, 17287073, 17340158, 18021253, 18041056, 18047741, 18165617, 18212329, 18381453, 18391590, 18925694, 18925847, 19470934, 19548138, 19601920, 19755989, 20502715, 20665500, 20673348, 20723915, 21258414, 21346035, 21491998, 21632885, 22125026, 22229848, 22899991, 23073296, 23148638, 23219378, 23462807, 23497256, 23867510, 23972708, 24130073, 24510280, 24593195, 24606948, 24610445, 24659637, 24767687, 24821582, 24943683, 24989926, 25062489, 25446042, 25538263, 25811348, 26021863, 26026587, 26044558, 26052049, 26114873, 26115098, 26214443, 26304926, 26310563, 26400342, 26465082, 26484606, 26597115, 26637866, 26701102, 27030134, 27407122, 27453294, 27583351, 27751729, 27844272, 28039484, 28040423, 28062400, 28103578, 28107584, 28123542, 28161830, 28166200, 28185218, 28192155, 28221861, 28276433, 28288043, 28330784, 28330808, 28338654, 28356760, 28489583, 28491148, 28521439, 28545581, 28562357, 28593813, 28676023, 28691643, 28832978, 28890247, 28971328, 28975890, 29051029, 29088109, 29212178, 29297707, 29309249, 29323560, 29325434, 29707987, 29718721, 29728867, 29784193, 29851529, 29854307, 29930727, 29942264, 30084668, 30122942, 30158285, 30158382, 30158581, 30195633, 30199151, 30206412, 30358217, 30372383, 30372392, 30478013, 30489037, 30497198, 30499710, 30513765, 30572736, 30640790, 30687324, 30689402, 30726882, 30924496, 31184937, 31258725, 31465470, 31485634, 31496820, 31501271, 31532565, 31554440, 31646819, 31752390, 31810797, 7846687, 8589021, 9120987, 9346879, 9756852		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15569051, 17255303, 17287073, 18349828		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30045814		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	10674029, 17994443, 18607348, 24067439, 25474224, 28601119, 29393270, 8738799		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28900259, 29980767, 30612004, 31699213		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29212519		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	17467022		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	15741444, 16807391, 17289863, 19349383, 19358726, 21797753, 28099389, 28578669, 30551503, 30651808, 31219247, 31374972, 31406128		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	22394267, 26172140		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	27928450	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	11839592, 23221067, 23644986, 29502235, 9261311, 9499769		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	29212537, 32823472	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10469350, 10494799, 11023552, 11345346, 11978667, 11980848, 12930159, 14988276, 15782399, 17121786, 17513698, 17869204, 17947829, 18853324, 19142872, 19263526, 19483196, 19768732, 19909248, 20591524, 20835900, 21056995, 21158590, 21228311, 21596454, 21738387, 21750722, 22064697, 22658411, 22956610, 23077404, 23141926, 23195430, 23233787, 23434931, 24751925, 24898870, 25169573, 25605522, 25866826, 25956512, 27388246, 27409056, 27922068, 28100839, 28322199, 28332616, 28356444, 28374767, 28421206, 28452992, 28455954, 28549848, 28662688, 28730075, 28767589, 28791491, 28931763, 28940930, 29017477, 29042140, 29076766, 29158916, 29191924, 29411894, 29464332, 29681725, 29721978, 29730824, 30093937, 30579324, 30664207, 30719863, 30825671, 31019585, 31583505, 31656158, 9815760		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	19324842		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	23439602, 27783271, 32855870, 32945388, 33065984	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	28257068	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Retinal Dysplasia	BEFREE	28192065		★☆☆☆☆ Found in Text Mining only
Retinal Pigment Epithelial Detachment	Retinal Pigment Epithelial Detachment	BEFREE	27755376		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	CTD_human_DG	16680105		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	LHGDN	18039346		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	19909248, 27685676, 27911446, 28639290, 28931763, 29098298, 29664983, 30267092, 30286219, 30457641, 31157714, 31173913, 31528507		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10211121, 11980848, 15269162, 15613498, 16936754, 19260835, 19860642, 25218456, 28588740, 29098028, 29392314, 30300333, 30312257, 30572521, 31311559, 8994354, 9261311		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17442832, 20157412, 20860824, 22457763, 25337214, 26619025	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	10751359	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	10875087, 11413193, 11727737, 12037012, 12840058, 12930159, 15161830, 15303088, 15352072, 15635051, 16146781, 16500767, 16565398, 16877277, 17119993, 18546007, 18568888, 19768732, 20457980, 20697002, 20706192, 20938001, 21738387, 21750722, 22773903, 23065202, 23094709, 23099493, 23296045, 23644986, 23972394, 24533641, 24874013, 25605522, 25992764, 26172140, 26477493, 26940670, 27388246, 27467377, 27842054, 27993591, 28087723, 28088487, 28137344, 28325857, 28573924, 29113524, 29260199, 29290015, 29312345, 29339088, 29386650, 29411894, 29464332, 29675549, 29730824, 29737539, 29792838, 29857790, 29948178, 30093937, 30100069, 30134834, 30383455, 30652694, 30658990, 30830544, 30914019, 31043645, 31174872, 31268499, 31314602, 31317786, 31564208, 31788758, 31800460, 8859081		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	11331770, 16735995, 25588190, 26365970, 27783271, 32728160, 33632168, 33811221, 37272765, 39260060, 40084286	Associate	★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	28272453	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	26471937		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	11103779, 16077930, 16116481, 22525722, 23255356, 25086956, 26553361, 30995126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	16116481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	CTD_human_DG	16116481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	26553361	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	26553361	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	28572674, 29568872, 31833198		★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	11212152	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10971521, 11469450, 11710707, 11751992, 12563678, 12794819, 12847684, 14528319, 15213335, 16163444, 16216669, 16277668, 16368150, 16386649, 16398617, 16519794, 17009243, 17103175, 17182109, 17302909, 17393418, 17530707, 18402776, 18512785, 18721452, 19379726, 21179282, 21245770, 21362767, 21388351, 22429695, 22776467, 22817681, 23343469, 23684916, 23848209, 23933487, 24309559, 25483913, 25828083, 25894998, 26135838, 26825024, 26922678, 26947206, 27465842, 27513931, 28067317, 28771010, 28850026, 28901512, 29088724, 29327326, 29490676, 29669300, 29717129, 29756413, 29949166, 29998825, 30224512, 30503342, 30767867, 30988781, 31234583, 31316573, 31401905, 31615077, 31669506, 31785770, 31820713, 31841174, 8006592, 9228120, 9933439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12168808, 17530707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	16368150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	BEFREE	21517900		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33626956	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	15627640	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	18702899		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	29991364		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	16456230, 25301555		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	11398859, 31173277		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	22990551	Associate	★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	31533751		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	17972532, 21948244, 23771070, 29521047	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11641969, 23181555	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	12740269, 18554246, 19741061, 26022899, 28506681, 29679363, 9463589		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	18554246		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	20169144, 26445225	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	20169144	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11213831, 12237927, 14977835, 16804907, 16951193, 19036083, 22304008, 22684860, 25843489, 26646755, 27374091, 27771610, 28185218, 28377452, 29141017, 29546033		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	14977835, 18344025, 18349828, 19107931		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	15015617, 16101185, 25973067, 27771610, 35069780, 38058118, 38086608	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24927770	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	19146682, 32127467	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	10705399	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	22643796, 29263143, 33682749	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10361120, 10640727, 15254407, 15542692, 15800227, 16861237, 19260835, 20660728, 21421336, 23936513, 26092770, 27208691, 31252633, 36890149, 8644848, 9621077	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	29893303	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	12015752		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19834500, 25641131, 28942562, 29467462, 29602597, 29677618, 29772306, 31842818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwannomatosis	Schwannomatosis	Pubtator	33025139	Associate	★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome, Type 1	Chondrodystrophic myotonia	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	22740248, 23096096		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24982919, 26584613, 39684939	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32085768	Stimulate	★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	31612234		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	9058706		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	15294883, 15892618, 15908664, 15998951, 16365183, 18046482, 18086000, 18613756, 20125120, 20399983, 21048041, 21188390, 21208841, 21407216, 21618508, 21669012, 21791631, 21844885, 22139032, 22231565, 22735932, 23161411, 23168366, 23579861, 24659637, 24701697, 24793846, 25531050, 25617075, 25707392, 25861837, 25982297, 26355232, 26372896, 26615857, 27002940, 27592068, 28103904, 28183254, 28209746, 28465540, 28531891, 28643862, 28712098, 28870907, 29061771, 29134647, 29228087, 29420426, 29574193, 29670046, 30019590, 30190299, 30224341, 30377339, 30396964, 30405103, 30411783, 30459123, 30863179, 30952738, 31177854, 31270570, 31394786, 31402291, 31443300, 31497360, 31646798, 31676953		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	22812626	Stimulate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	36820574	Associate	★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	23438977		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	12653578, 19176759, 21371321, 25885541	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	15613012, 20213923	Stimulate	★☆☆☆☆ Found in Text Mining only
Septal hypertrophy	Septal Hypertrophy	BEFREE	23007030		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	23669075, 28086962, 30222136, 30335688, 31013257, 31165286, 31726451		★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	18574502, 31198634		★☆☆☆☆ Found in Text Mining only
Serous retinal detachment	Serous Retinal Detachment	BEFREE	28406860, 29292162		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	23608225		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	28203105		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	23953100		★☆☆☆☆ Found in Text Mining only
SHWACHMAN-DIAMOND SYNDROME 1	Shwachman-Diamond Syndrome	BEFREE	15368588		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	29545886, 31243775		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	11300331, 11875737, 9376264	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	19468049		★☆☆☆☆ Found in Text Mining only
Sinonasal undifferentiated carcinoma	Sinonasal undifferentiated carcinoma	BEFREE	23633104		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	28598679		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24772480	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25636309	Inhibit	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29558032, 35705251, 36999025	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22413008	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	23166713, 9328154	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	14528319		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24504098, 26966180		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	22262122, 8941211		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	23166713, 35886018	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	16085213	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	25541696, 27108420, 28514291, 29997451, 33737411, 36479843	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	15588038, 16085213	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	16085213		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	31485183		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	16085213, 17044926, 23923005, 25541696, 27108420, 27236786, 28514291, 29671205		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28147322		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10646866, 11326319, 11953815, 12845630, 16818499, 17505039, 21843314, 27901478, 29776963, 30203184		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	18317954		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	11870537, 15330186, 18671849, 21718596, 26823791, 35641209	Associate	★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	29257210		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	9823778	Stimulate	★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	26956787		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 11	Spinocerebellar ataxia	Pubtator	19077470	Associate	★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	22001907, 30649233		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	18534064	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	28351491		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26125893, 33958655	Associate	★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	26790967, 28599872, 29774103		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia	Spondyloepiphyseal dysplasia	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia Tarda, X-Linked	Spondyloenchondrodysplasia	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	18171601, 20981515, 23390884, 24528036		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10023341, 10213212, 10623663, 11102890, 14708636, 14719061, 14981918, 15123463, 15540202, 15788677, 16144770, 16227395, 16398617, 16607275, 18485799, 19324448, 19603236, 19834490, 19942948, 20042679, 20618614, 21480395, 22171990, 22466894, 22818823, 23166713, 23227881, 23441128, 23982876, 24833243, 25158264, 25738362, 26058869, 26476432, 26861159, 27577989, 27876017, 28174788, 28523303, 28564590, 29149180, 29289482, 29462614, 29516931, 29970531, 29976150, 29980198, 30065361, 31035945, 31572671, 31658318, 31696949, 31777532, 9683299, 9816315		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12168898, 12452000, 12860293, 12883661, 14708636, 15173661, 15254682, 15847702, 16499871, 17511025, 17564725, 17982650, 18285708, 18299215, 18802921, 19209155		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15956251, 26432044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10938383, 14991568, 17511025, 18641541, 19440651, 23155356, 24122254, 24284961, 24945674, 25624724, 26099724, 26323923, 28356983, 28599478, 28818096, 29800478, 30015941, 30126380, 30854051, 31595395, 31824776, 9635853		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10023341, 10952783, 11050477, 15330158, 15475932, 16641910, 16827115, 18225538, 18283272, 18836279, 19300368, 20498643, 20546613, 21316013, 21595617, 21656745, 22203927, 22203933, 22366441, 22466894, 22583829, 23370231, 23506259, 23645351, 24716969, 25457070, 25674742, 26058869, 26630663, 26666815, 27329726, 29149180, 29289482, 29516931, 30041677, 30718984, 31018946, 33096435, 33232279, 33941139, 34284746, 35220896, 35419461, 35922788, 35949109, 36007290, 36708576, 37443802, 38006346, 38376273, 39261828, 39382421, 39412903	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19480853, 20702412, 24577893, 37322630, 39873996	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	28523303		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	10397456, 24098368, 29862232, 31322197		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	10213212, 23166713, 27729640, 30825266		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10213212, 10779196, 10897108, 11078794, 11234901, 11479233, 12063543, 12888890, 15330158, 15592503, 16103054, 16499871, 16507411, 17169602, 18164965, 18283272, 19082496, 20222044, 20393000, 21177768, 21249316, 21301321, 21343546, 21656745, 22494072, 24436242, 25762616, 27078157, 27777979, 28521433, 28714017, 28718364, 30904360		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	25158264		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	16227395, 18485799, 22466894, 22552321, 25960229, 31516609		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	12119553		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28558042, 30910283		★☆☆☆☆ Found in Text Mining only
Stargardt Disease	Stargardt disease	Pubtator	34486473	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	17533168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	28193596, 28235602, 28410463, 31178701		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22658783, 28710554, 31254006, 9917513		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	16951193, 19351758, 24927770, 27771610		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	10027945, 12558813		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10440683, 11819817, 11857038, 12508347, 14532971, 14669355, 14710231, 15112337, 15112366, 15153787, 15349119, 15746037, 15864753, 16004935, 17094412, 17111394, 17334712, 17426061, 17465445, 17671399, 18089723, 18200665, 18373164, 18383582, 18708754, 18972599, 19496079, 19566948, 19581046, 19676106, 19835575, 21089052, 21161943, 21344505, 21617872, 21633597, 21769478, 21840308, 22292637, 22350700, 22460086, 22729879, 22808003, 22895814, 23264084, 23573305, 23625175, 23728938, 23801279, 24401755, 24744582, 25096402, 25320512, 25444928, 25596740, 25847144, 25886574, 26115478, 26250887, 26566627, 26937132, 27224240, 27280289, 27352182, 27976952, 27993216, 28281844, 28321168, 28362978, 28459196, 28581513, 28730780, 28738343, 29142602, 29228421, 29228423, 29344744, 29390928, 29391882, 29399168, 29706652, 29761299, 29853970, 29914006, 29960070, 30010108, 30380970, 30410610, 30980943, 31117964, 31611999, 31725767, 31749879, 31811909, 31850212		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	18273500	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	23404437	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	11819817, 11978184, 12708473, 15112337, 15217947, 15457582, 15515423, 16086118, 16761623, 17001321, 17393106, 17409493, 17426061, 17461470, 17671399, 18181047, 18373164, 18383582, 18452596, 18609713, 18972599		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11978184, 12174362, 12439912, 12460468, 12509426, 12618892, 12647634, 12708473, 12854133, 12854174, 14666382, 14710231, 15029262, 15112337, 15112366, 15274366, 15309707, 15457582, 15682485, 15929167, 16495697, 16810742, 17094486, 17171787, 17224647, 17409493, 17426061, 17461470, 17465445, 17695481, 18200665, 18273500, 18452596, 18516318, 18972599, 19068081, 19287200, 19331191, 19566948, 19835575, 20563765, 20593045, 21089052, 21118571, 21134074, 21633597, 21672207, 21777278, 22246794, 22289522, 22460086, 22808003, 23089909, 23151184, 23303024, 23321169, 23374220, 23394613, 23422754, 23599627, 23625175, 23755751, 24116074, 24120241, 24158524, 24209632, 24241899, 24322015, 24488015, 24507679, 24817013, 24850176, 25884175, 27198692, 27342370, 27384994, 27503021, 27590684, 27597973, 28459196, 28493075, 29077165, 29228421, 29336669, 29808160, 29899167, 29914006, 30010108, 31117964, 31173290, 31725767, 31939450, 32899018, 32958054, 35417854, 35771149, 35866593, 35936358, 36091938, 36748372, 36833207, 37108312, 37794689, 39272096, 39457390, 39521152, 9862566	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23001403		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23117246, 29228423, 38319150	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35069035, 37226719	Inhibit	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	11807987, 18287964, 20872175, 26940670, 26957058, 28197761, 28595487, 29193649, 29469063, 29664206, 29790692, 29984822, 30070315, 30323877, 30835573		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28234972, 32506171, 36820574, 39762845	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39969331	Stimulate	★☆☆☆☆ Found in Text Mining only
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	17204940		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	23728502, 30240794, 30382533, 31169190, 31360727		★☆☆☆☆ Found in Text Mining only
Subcutaneous hemorrhage	Subcutaneous hemorrhage	BEFREE	12565870		★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	21224066		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	24260093, 30181178		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	20636397	Stimulate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	21658319	Associate	★☆☆☆☆ Found in Text Mining only
Synovial Hypertrophy	Synovial Hypertrophy	BEFREE	26825024		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	10910082, 29456663, 29803658, 29893303		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	10820274, 14528319, 25889955		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	LHGDN	17103175		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	20668498, 36598310	Associate	★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	30406853		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	30406853		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	14742681, 15178641, 16740682, 21636803, 22740248, 22867700, 23096096, 24982919, 25248297, 26359450, 28159016, 28183357, 28320472, 28545512, 29528272, 29787366, 30245695, 31075243		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25488971, 26855318, 30814977		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	16620970		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	LHGDN	16620970		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30657078, 31573481		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	11115562, 15517881, 17628298, 18645275, 20884251, 22392726, 9823778		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	24587130, 25839219, 33894400, 35343049	Associate	★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	24667223, 33211216	Stimulate	★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	26239269		★☆☆☆☆ Found in Text Mining only
Tendinitis	Tendinitis	BEFREE	30233367		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	27930691		★☆☆☆☆ Found in Text Mining only
Testicular Hydrocele	Testicular Hydrocele	BEFREE	17978056		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	8760299		★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	29611450		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	16456230, 19308252, 22683047, 23897578, 25894981, 26558525, 30232381		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	26558525, 30232381, 34328347	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	12111782, 23314673	Associate	★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	9845647	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24463275, 30781507	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	11891801		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	20473593, 20615083, 21217153, 24463275		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Platelet Dysfunction Hemolysis and Imbalanced Globin Synthesis	Thrombocytopenia	Pubtator	25421114	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	29739345		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	31139312		★☆☆☆☆ Found in Text Mining only
Thrombophlebitis	Thrombophlebitis	Pubtator	30420902	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24294378, 27928450, 30781507	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	32203583	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis of retinal vein	Thrombosis of retinal vein	CTD_human_DG	16680105		★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	18337603, 24067439, 27918307, 28183278, 28775003, 28835895, 29249229, 30014486, 30634936, 30642877, 31264312, 31316523, 31699213		★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	CTD_human_DG	22808199		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	24870739, 27387303		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	24870739		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	19255327, 24670538, 27925342, 28178662, 28425432, 29655286, 30678450, 31378898, 32151175, 32615729, 32824922, 33721460, 34781815, 34927541, 40430098	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24884830	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10194527, 10490819, 11873861, 14602779, 15994743, 16260429, 16398617, 16940797, 17951537, 20142332, 21093207, 22066479, 22711876, 23845470, 24687553, 25971967, 26244545, 27067785, 28178662, 29956628, 31174237, 31186313, 9360534		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31183379, 31545405	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	26955881, 27494076		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	9177415		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10490819, 14570746, 14602779, 15994743, 16260429, 16398617, 16940797, 17951537, 20142332, 21093207, 22711876, 24670538, 24687553, 25971967, 26244545, 27067785, 31174237, 7478581, 9360534		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17893268, 17951537, 18450769, 19041000		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10595926, 18596272, 20237991, 22548798, 22577338, 22641097, 22890443, 23771538, 24687553, 28178662, 32824922, 33721460, 35313079, 35813296, 36253663	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29953504	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	9177415		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	10194527, 29044016		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	17696908	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	15311211, 26955881, 27494076	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	23155356	Associate	★☆☆☆☆ Found in Text Mining only
Total anomalous pulmonary venous return	Pulmonary Venous Return Anomaly	BEFREE	7847375		★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	24189491		★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	29653519		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30678250		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12474525, 17296440, 18513850, 18645275, 23613251, 26129954, 26798188, 29867225		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	21082502, 26279462, 28699668, 31012139		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	11556826, 23340303, 23667446, 25356777, 25824321, 27484639, 29049198, 29936177, 31059004, 31235595, 32406563, 33219203, 34791795, 35710947, 37389973, 37657065, 37713894, 38169627	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	19549711, 21259255, 23232696, 23340303, 23436775, 23667446, 25356777, 25391896, 25824321, 26232605, 27137076, 27292261, 27364975, 29031923, 29049198, 29230610, 29936177, 30126858, 30405852, 30498230, 30508942, 30635009, 30800223, 30848190, 30900382, 31235595, 31285776		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19549711, 35268073	Stimulate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	25713110		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	21224066, 28092822		★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	21224066		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	29462614, 29783929		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	LHGDN	16283008		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	30245717		★☆☆☆☆ Found in Text Mining only
Ulcer of esophagus	Ulcer Of Esophagus	BEFREE	22300081, 25059824		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10102229, 21115119, 25076849, 29556626, 30892485		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uncinate Epilepsy	Epilepsy	CTD_human_DG	17533168		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	27067785, 9815567		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	17257729, 19700204, 24718046, 26726958, 28267147, 28340040, 28448948, 29968119, 30406404, 31057436, 31103810, 31823655		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	16499871		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	25000894, 28733472		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	34858433	Associate	★☆☆☆☆ Found in Text Mining only
Ureteral Obstruction	Urethral obstruction	Pubtator	23690937	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neck Obstruction	Urinary bladder neck obstruction	Pubtator	25951999	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10638984, 11953885, 11980898, 17319747, 18930813, 19190164, 19682434, 19692168, 20571940, 22558473, 23613251, 24448324, 25387487, 26193287, 26798188, 28206971, 28423532, 29556633, 29867225, 29959793, 30816487, 32234826, 35563650, 36579659, 36581931, 36982218, 37455529, 8238242, 9823778	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22895562	Stimulate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic Neoplasms	BEFREE	10365146, 30195633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic Neoplasms	CTD_human_DG	23009795		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic neoplasm	Pubtator	26397152	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	20593288, 21167264, 23009795, 24448750		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19479977	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21543926, 23098453, 25536602, 9400935	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	17505511, 17671679		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10360662, 10944602, 15483346, 17505511, 18629779, 18847499, 19352388, 19574782, 21213129, 21424032, 21546870, 21792010, 23861821, 23873179, 24782650, 25135429, 25536602, 25824750, 26399340, 26526574, 28304186, 29654110, 30338794, 30458457, 30468461, 30785571, 31082770, 32669083, 32851067, 33099935, 34693869, 35983073, 37335690, 38425023, 38555994, 40238841	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17678892	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25855930	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Diseases	Uterine polyp	Pubtator	24260517, 26769301	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	24471989	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26586929	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11035983, 18256925, 21056306, 26884457, 27748285, 28010141, 28338206		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	10596910, 15671530, 20042655, 23077404, 26761211, 30483120, 30702560, 31234419, 8994354		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	10873988, 11914215, 20036848, 27476775, 31765784	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	31256417		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	33639877, 35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	27060382		★☆☆☆☆ Found in Text Mining only
Van Buchem disease	Van Buchem Disease	CTD_human_DG	24235232		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	26867642		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	14760594, 30498761	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	32594304	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	14760594, 22368191, 26299356, 27932624, 30498761, 31427387		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	10780661, 24316428, 28300464, 28918499, 30719863, 30871567, 32879419, 33499313, 33515594, 34565088, 34858433, 9665461	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12896876, 16730575, 19622383, 19716049, 19768732, 21782920, 22762535, 22867700, 25172656, 26588727, 27865734, 28918499, 29392309, 29739345, 29954686, 29974845, 30032215, 30535424, 30706940, 31787868		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22555639, 27612459	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	10212108, 28399937	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	20808962, 26768002, 30420902, 37415174, 37903435	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	16546368	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	20805419, 24607726, 30080295		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	26429157	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	28724574, 31573481		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	29884860	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	31886225	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	23086340		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	27481876, 32851067	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	23690937, 34440447	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	17625508		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	LHGDN	17625508		★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	17597658, 31832877		★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	LHGDN	17597658		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	17597658, 22558067, 31832877		★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	33172148, 34721402	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29991364, 30116739		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	35213796	Associate	★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform macular dystrophy	Pubtator	30498755	Associate	★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform macular dystrophy	Pubtator	34794403	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	31135085		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	31135085		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	24227910, 28572674, 31700227, 9486038	Associate	★☆☆☆☆ Found in Text Mining only
Vohwinkel Syndrome, Variant Form	Vohwinkel Syndrome	BEFREE	20236940		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10475065, 10804089, 11114720, 11310918, 11772947, 12539169, 16627979, 17070589, 17218907, 17332933, 17992257, 22300081, 25310734, 26304926, 27844272, 28662711, 29805741, 30497198, 7533661, 8625303, 8855222, 9346879		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 3	von Willebrand disorder	BEFREE	29304535		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	31531336		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	28469969, 9669344		★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Stimulate	★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	34560403	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	12560388, 21594709	Associate	★☆☆☆☆ Found in Text Mining only