VCX3A (variable charge X-linked 3A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51481
Gene name Variable charge X-linked 3A
Gene symbol VCX3A
Synonyms (NCBI Gene)
VCX-8rVCX-AVCX3VCX8RVCXA
Chromosome X
Chromosome location Xp22.31
Summary This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies o
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus ISS
GO:0005730 Component Nucleolus ISS
GO:0007420 Process Brain development IBA
GO:0007420 Process Brain development IMP 10903929
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300533 18159 ENSG00000169059
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NNX9
Protein name Variable charge X-linked protein 3 (Variable charge protein on X with eight repeats) (VCX-8r) (Variably charged protein X-A) (VCX-A)
Protein function May mediate a process in spermatogenesis or may play a role in sex ratio distortion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15231 VCX_VCY 1 → 129 Variable charge X/Y family Family
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively in testis.
Sequence 
MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMA
AVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEV
EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEM
EELPSV
Sequence length 186
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
VCX3A-related disorder Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (21)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 24970476
★★★★★
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 16470742
★★★★★
★☆☆☆☆
Found in Text Mining only
Azoospermia Nonobstructive Nonobstructive azoospermia Pubtator 36017582 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Borderline intellectual disability Mental retardation BEFREE 17113756
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 28412734 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28412734 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 24970476 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Congenital chromosomal disease Congenital Chromosomal Disease BEFREE 23791652
★★★★★
★☆☆☆☆
Found in Text Mining only
Congenital ichthyosis Congenital Ichthyosis BEFREE 28122887
★★★★★
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 29453317 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for VCX3A.

No additional diseases found yet through genes similar to VCX3A.