Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	26609
Gene name	Variable charge X-linked
Gene symbol	VCX
Synonyms (NCBI Gene)	VCX-10rVCX-B1VCX1VCX10RVCXB1
Chromosome	X
Chromosome location	Xp22.31
Summary	This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies o

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	TAS	12862317
GO:0005634	Component	Nucleus	IDA	12862317
GO:0005730	Component	Nucleolus	IDA	12862317
GO:0006325	Process	Chromatin organization	TAS	12862317
GO:0007283	Process	Spermatogenesis	TAS	10607842
GO:0007420	Process	Brain development	IBA
GO:0042255	Process	Ribosome assembly	NAS	12862317

MIM	HGNC	e!Ensembl
300229	12667	ENSG00000182583

Q9H320

Protein name

Variable charge X-linked protein 1 (Variable charge protein on X with ten repeats) (VCX-10r) (Variably charged protein X-B1) (VCX-B1)

Protein function

May mediate a process in spermatogenesis or may play a role in sex ratio distortion.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15231	VCX_VCY	1 → 129	Variable charge X/Y family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed exclusively in testis.

Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMA
AVTAPEAESAPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQEAELEEPLSQESEV
EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEM
EEPLSQESQVEEPPSQESEMEELPSV

Sequence length

206

Interactions

View interactions

Related Genes Genes most often co-reported with VCX across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for VCX.

Diseases Linked via Similar Genes Diseases curated for genes most similar to VCX (see Related Genes above), that are NOT already directly curated for VCX itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to VCX.

VCX (variable charge X-linked)

Save This Analysis