VCPKMT (valosin containing protein lysine methyltransferase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79609
• Gene name: Valosin containing protein lysine methyltransferase
• Gene symbol: VCPKMT
• Synonyms (NCBI Gene): C14orf138, METTL21D, VCP-KMT
• Chromosome: 14
• Chromosome location: 14q21.3

miRNA Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT441086	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT441084	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT441086	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT728152	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT728151	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT728150	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT728149	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT441084	hsa-miR-20a-5p	HITS-CLIP	22473208

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22948820, 23349634, 32296183
GO:0005737	Component	Cytoplasm	IDA	23349634
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008276	Function	Protein methyltransferase activity	IEA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IBA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IDA	22948820, 23349634
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IEA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0018022	Process	Peptidyl-lysine methylation	IMP	23349634
GO:0018023	Process	Peptidyl-lysine trimethylation	IDA	22948820
GO:0032259	Process	Methylation	IEA
GO:0032780	Process	Negative regulation of ATP-dependent activity	IMP	23349634
GO:0032991	Component	Protein-containing complex	IBA
GO:0032991	Component	Protein-containing complex	IDA	23349634
GO:0032991	Component	Protein-containing complex	IEA
GO:0051117	Function	ATPase binding	IPI	23349634

Other IDs

• MIM: 615260
• HGNC: 20352
• e!Ensembl: ENSG00000100483

Protein

• UniProt ID: Q9H867
• Protein name: Protein N-lysine methyltransferase METTL21D (EC 2.1.1.-) (Methyltransferase-like protein 21D) (VCP lysine methyltransferase) (VCP-KMT) (Valosin-containing protein lysine methyltransferase)
• Protein function: Protein N-lysine methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.
• PDB: 4LG1 , 7OAT , 8HL6 , 8HL7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10294	Methyltransf_16	22 → 195	Lysine methyltransferase	Family

• Sequence:

  MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSG
  DGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQ
  AKVLKWGEEIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGK
  NPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFPS

• Sequence length: 229

Pathways

Reactome Pathway:

Protein methylation

Related Genes

No strongly related genes found yet for VCPKMT.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to VCPKMT.