Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7412
Gene name	Vascular cell adhesion molecule 1
Gene symbol	VCAM1
Synonyms (NCBI Gene)	CD106INCAM-100
Chromosome	1
Chromosome location	1p21.2
Summary	This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004007	hsa-miR-200a-3p	Microarray	17875710
MIRT004081	hsa-miR-126-3p	Luciferase reporter assayWestern blot	18227515
MIRT004081	hsa-miR-126-3p	Luciferase reporter assayWestern blot	18227515
MIRT020917	hsa-miR-155-5p	qRT-PCR	21310411
MIRT004081	hsa-miR-126-3p	Reporter assay;Other	18227515
MIRT715363	hsa-miR-181a-5p	HITS-CLIP	19536157
MIRT715362	hsa-miR-181c-5p	HITS-CLIP	19536157
MIRT715361	hsa-miR-181d-5p	HITS-CLIP	19536157
MIRT715360	hsa-miR-4262	HITS-CLIP	19536157
MIRT715359	hsa-miR-181b-5p	HITS-CLIP	19536157
MIRT715358	hsa-miR-506-5p	HITS-CLIP	19536157
MIRT715357	hsa-miR-211-3p	HITS-CLIP	19536157
MIRT715356	hsa-miR-4270	HITS-CLIP	19536157
MIRT715355	hsa-miR-4441	HITS-CLIP	19536157
MIRT715354	hsa-miR-6754-5p	HITS-CLIP	19536157
MIRT715353	hsa-miR-3691-3p	HITS-CLIP	19536157
MIRT715352	hsa-miR-3127-5p	HITS-CLIP	19536157
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT707385	hsa-miR-3183	HITS-CLIP	21572407
MIRT707384	hsa-miR-4723-3p	HITS-CLIP	21572407
MIRT707383	hsa-miR-6769b-3p	HITS-CLIP	21572407
MIRT707382	hsa-miR-136-5p	HITS-CLIP	21572407
MIRT707381	hsa-miR-6845-3p	HITS-CLIP	21572407
MIRT707380	hsa-miR-7110-3p	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	23313552
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT504350	hsa-miR-23c	HITS-CLIP	23313552
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT635479	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT635478	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT635477	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT635476	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT635475	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT635474	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT635473	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT610905	hsa-miR-5092	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT533259	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT533258	hsa-miR-6856-3p	PAR-CLIP	22012620
MIRT533257	hsa-miR-5694	PAR-CLIP	22012620
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT533256	hsa-miR-96-3p	PAR-CLIP	22012620
MIRT533255	hsa-miR-2467-3p	PAR-CLIP	22012620
MIRT533254	hsa-miR-2116-5p	PAR-CLIP	22012620
MIRT533253	hsa-miR-22-5p	PAR-CLIP	22012620
MIRT533252	hsa-miR-6844	PAR-CLIP	22012620
MIRT533251	hsa-miR-1273h-3p	PAR-CLIP	22012620
MIRT533250	hsa-miR-3678-3p	PAR-CLIP	22012620
MIRT533249	hsa-miR-4677-5p	PAR-CLIP	22012620
MIRT533248	hsa-miR-6516-5p	PAR-CLIP	22012620
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT533255	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT533257	hsa-miR-5694	PAR-CLIP	27292025
MIRT533248	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT004081	hsa-miR-126-3p	Luciferase reporter assayWestern blottingqRT-PCR	31474826
MIRT715363	hsa-miR-181a-5p	HITS-CLIP	19536157
MIRT715362	hsa-miR-181c-5p	HITS-CLIP	19536157
MIRT715361	hsa-miR-181d-5p	HITS-CLIP	19536157
MIRT715360	hsa-miR-4262	HITS-CLIP	19536157
MIRT715359	hsa-miR-181b-5p	HITS-CLIP	19536157
MIRT715358	hsa-miR-506-5p	HITS-CLIP	19536157
MIRT715357	hsa-miR-211-3p	HITS-CLIP	19536157
MIRT715356	hsa-miR-4270	HITS-CLIP	19536157
MIRT715355	hsa-miR-4441	HITS-CLIP	19536157
MIRT715354	hsa-miR-6754-5p	HITS-CLIP	19536157
MIRT715353	hsa-miR-3691-3p	HITS-CLIP	19536157
MIRT715352	hsa-miR-3127-5p	HITS-CLIP	19536157
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT707385	hsa-miR-3183	HITS-CLIP	21572407
MIRT707384	hsa-miR-4723-3p	HITS-CLIP	21572407
MIRT707383	hsa-miR-6769b-3p	HITS-CLIP	21572407
MIRT707382	hsa-miR-136-5p	HITS-CLIP	21572407
MIRT707381	hsa-miR-6845-3p	HITS-CLIP	21572407
MIRT707380	hsa-miR-7110-3p	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	23313552
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT504350	hsa-miR-23c	HITS-CLIP	23313552
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT635479	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT635478	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT635477	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT635476	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT635475	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT635474	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT635473	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT610905	hsa-miR-5092	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT533259	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT533258	hsa-miR-6856-3p	PAR-CLIP	22012620
MIRT533257	hsa-miR-5694	PAR-CLIP	22012620
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT533256	hsa-miR-96-3p	PAR-CLIP	22012620
MIRT533255	hsa-miR-2467-3p	PAR-CLIP	22012620
MIRT533254	hsa-miR-2116-5p	PAR-CLIP	22012620
MIRT533253	hsa-miR-22-5p	PAR-CLIP	22012620
MIRT533252	hsa-miR-6844	PAR-CLIP	22012620
MIRT533251	hsa-miR-1273h-3p	PAR-CLIP	22012620
MIRT533250	hsa-miR-3678-3p	PAR-CLIP	22012620
MIRT533249	hsa-miR-4677-5p	PAR-CLIP	22012620
MIRT533248	hsa-miR-6516-5p	PAR-CLIP	22012620
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT756150	hsa-miR-95-3p	Western blottingqRT-PCR	36467343
MIRT756469	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1483204	hsa-miR-2116	CLIP-seq
MIRT1483205	hsa-miR-4269	CLIP-seq
MIRT1483206	hsa-miR-4514	CLIP-seq
MIRT1483207	hsa-miR-452	CLIP-seq
MIRT1483208	hsa-miR-4676-3p	CLIP-seq
MIRT1483209	hsa-miR-4692	CLIP-seq
MIRT1483210	hsa-miR-4742-5p	CLIP-seq
MIRT1483211	hsa-miR-507	CLIP-seq
MIRT1483212	hsa-miR-557	CLIP-seq
MIRT1483213	hsa-miR-577	CLIP-seq
MIRT1555382	hsa-miR-1825	CLIP-seq
MIRT1555383	hsa-miR-202	CLIP-seq
MIRT1555384	hsa-miR-204	CLIP-seq
MIRT1555385	hsa-miR-211	CLIP-seq
MIRT1555386	hsa-miR-3121-5p	CLIP-seq
MIRT1555387	hsa-miR-3130-5p	CLIP-seq
MIRT1555388	hsa-miR-4287	CLIP-seq
MIRT1555389	hsa-miR-4482	CLIP-seq
MIRT1555390	hsa-miR-4678	CLIP-seq
MIRT1555391	hsa-miR-4685-3p	CLIP-seq
MIRT1555392	hsa-miR-4766-5p	CLIP-seq
MIRT1555393	hsa-miR-4795-3p	CLIP-seq
MIRT2365788	hsa-miR-1207-3p	CLIP-seq
MIRT2365789	hsa-miR-3974	CLIP-seq
MIRT2365790	hsa-miR-545	CLIP-seq
MIRT2659385	hsa-miR-1284	CLIP-seq
MIRT2659386	hsa-miR-3124-3p	CLIP-seq
MIRT1555387	hsa-miR-3130-5p	CLIP-seq
MIRT2659387	hsa-miR-3144-3p	CLIP-seq
MIRT2659388	hsa-miR-3605-3p	CLIP-seq
MIRT2659389	hsa-miR-3678-5p	CLIP-seq
MIRT2659390	hsa-miR-3919	CLIP-seq
MIRT2659391	hsa-miR-3945	CLIP-seq
MIRT2659392	hsa-miR-4253	CLIP-seq
MIRT1555389	hsa-miR-4482	CLIP-seq
MIRT2659393	hsa-miR-4528	CLIP-seq
MIRT2659394	hsa-miR-4712-5p	CLIP-seq
MIRT2659395	hsa-miR-4797-5p	CLIP-seq
MIRT2659396	hsa-miR-494	CLIP-seq
MIRT2659397	hsa-miR-770-5p	CLIP-seq
MIRT2659385	hsa-miR-1284	CLIP-seq
MIRT2659386	hsa-miR-3124-3p	CLIP-seq
MIRT1555387	hsa-miR-3130-5p	CLIP-seq
MIRT2659387	hsa-miR-3144-3p	CLIP-seq
MIRT2659388	hsa-miR-3605-3p	CLIP-seq
MIRT2659389	hsa-miR-3678-5p	CLIP-seq
MIRT2659390	hsa-miR-3919	CLIP-seq
MIRT2659391	hsa-miR-3945	CLIP-seq
MIRT2659392	hsa-miR-4253	CLIP-seq
MIRT1555389	hsa-miR-4482	CLIP-seq
MIRT2659393	hsa-miR-4528	CLIP-seq
MIRT2659394	hsa-miR-4712-5p	CLIP-seq
MIRT2659395	hsa-miR-4797-5p	CLIP-seq
MIRT2659396	hsa-miR-494	CLIP-seq
MIRT2659397	hsa-miR-770-5p	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
EP300	Activation	19281832
HDAC4	Activation	19281832
HOXA9	Unknown	22269951
IKBKB	Repression	18600306
IRF1	Unknown	15265939;22182512
JUN	Activation	16271621
NFKB1	Activation	10329958;10946302;11359843;16271621;16317091;16385502;19281832;19422386;22708120
NFKB1	Unknown	10553096;10833420;16453001
POU2F1	Repression	9694713
RELA	Activation	10329958;10946302;11359843;16317091;16385502;19281832;19422386;22708120
RELA	Unknown	10553096;10833420;16453001;23042817

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0002102	Component	Podosome	IDA	15220135
GO:0002544	Process	Chronic inflammatory response	IEA
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IDA	1377228, 15220135, 23620790
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IMP	19738201
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005615	Component	Extracellular space	IEA
GO:0005769	Component	Early endosome	IDA	23474851
GO:0005783	Component	Endoplasmic reticulum	IDA	23474851
GO:0005794	Component	Golgi apparatus	IDA	23474851
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	12878595
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	12082081
GO:0006954	Process	Inflammatory response	IC	9572733
GO:0006954	Process	Inflammatory response	IDA	22970700
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	16809613
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	1715889
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	1381355, 1715889, 2688898
GO:0007160	Process	Cell-matrix adhesion	IDA	18308860
GO:0007584	Process	Response to nutrient	IEA
GO:0008131	Function	Primary methylamine oxidase activity	IDA	23474851
GO:0009308	Process	Amine metabolic process	IDA	23474851
GO:0009897	Component	External side of plasma membrane	IDA	1377228
GO:0009986	Component	Cell surface	IDA	1715889, 23474851
GO:0009986	Component	Cell surface	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0010212	Process	Response to ionizing radiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0022614	Process	Membrane to membrane docking	IEP	12082081
GO:0030175	Component	Filopodium	IDA	12082081
GO:0030183	Process	B cell differentiation	IC	1715889
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033631	Process	Cell-cell adhesion mediated by integrin	IGI	11078691
GO:0034113	Process	Heterotypic cell-cell adhesion	IGI	11078691
GO:0035094	Process	Response to nicotine	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	1381355
GO:0042383	Component	Sarcolemma	IEA
GO:0045177	Component	Apical part of cell	IDA	12082081
GO:0045471	Process	Response to ethanol	IEA
GO:0050839	Function	Cell adhesion molecule binding	IDA	1377228
GO:0050839	Function	Cell adhesion molecule binding	IPI	12082081
GO:0050901	Process	Leukocyte tethering or rolling	IDA	18308860
GO:0050901	Process	Leukocyte tethering or rolling	IEP	2688898
GO:0060326	Process	Cell chemotaxis	IEA
GO:0060384	Process	Innervation	IEA
GO:0060945	Process	Cardiac neuron differentiation	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071065	Component	Alpha9-beta1 integrin-vascular cell adhesion molecule-1 complex	IDA	15220135
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098631	Function	Cell adhesion mediator activity	IDA	22970700
GO:1904646	Process	Cellular response to amyloid-beta	IGI	11078691

MIM	HGNC	e!Ensembl
192225	12663	ENSG00000162692

P19320

Protein name

Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) [Cleaved into: Soluble Vascular Cell Adhesion Molecule-1]

Protein function

Cell adhesion glycoprotein predominantly expressed on the surface of endothelial cells that plays an important role in immune surveillance and inflammation (PubMed:31310649). Acts as a major regulator of leukocyte adhesion to the endothelium thr

PDB

1IJ9 , 1VCA , 1VSC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	25 → 112	Immunoglobulin I-set domain	Domain
PF05790	C2-set	133 → 221	Immunoglobulin C2-set domain	Domain
PF00047	ig	229 → 306	Immunoglobulin domain	Domain
PF07679	I-set	314 → 400	Immunoglobulin I-set domain	Domain
PF05790	C2-set	421 → 509	Immunoglobulin C2-set domain	Domain
PF13927	Ig_3	515 → 583		Domain
PF07679	I-set	605 → 685	Immunoglobulin I-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue.

Sequence

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV

Sequence length

739

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEMIA, SICKLE CELL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS OF PREGNANCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRAHEPATIC CHOLESTASIS OF PREGNANCY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY GRAFT DYSFUNCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UREMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (499)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	11922919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20112284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31059081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16327982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18473733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30389659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16453001, 19533685, 28110427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	20714794		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	25175566		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	25175566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22801742, 33720880	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29359159, 31377428, 37762058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	17270454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11318968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	11318968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32586411	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	20443870, 28764810	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10477680, 10706764, 12034693, 15114598, 21088296, 21264913, 24075742, 34956203, 39776915, 7537985, 7691241, 9371854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10807794	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12393616, 21264913, 24075742, 24168396, 25175566, 25596272, 31015205		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Sickle Cell	Anemia	CTD_human_DG	16916123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angina Pectoris	Angina pectoris	Pubtator	16157948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	10475771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	35942210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	29059678		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29670110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	22288586, 37014642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37914735	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	10917982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20472891, 25832031, 30354818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	15120829, 37175670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	31843279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	10477680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11133225, 11225735, 11243852, 11755917, 11904449, 16246346, 17343848, 17394445, 17885011, 18093596, 18420209, 18602074, 19654051, 19851078, 19874473 View all (37 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	LHGDN	15784173		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	29052569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17922685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26859834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	27123929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11310827, 31864394, 7693825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10233853, 37958839	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10447928, 10817566, 10817567, 11171698, 11477102, 12105209, 1374588, 16385502, 17009243, 19597294, 20039412, 22275188, 23632129, 30033738, 31812161 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12296865	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10514490, 15661077, 35056403, 7545095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11398072, 15474861, 28093225, 28584245, 29614819, 31178661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15059493, 15661077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10438951, 7530745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15265232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10377075, 10892347, 12714597, 15784173, 15866588, 17586618, 17885011, 18084847, 18420209, 21496279, 24075742, 25003524, 25413339, 26008233, 26647279 View all (14 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11133225, 11225735, 11243852, 11755917, 11904449, 16246346, 17343848, 17394445, 17885011, 18093596, 18420209, 18602074, 19654051, 19851078, 19874473 View all (37 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	11904449, 12714597, 14684616		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	12677255		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	27941341	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18227384, 28355442, 28821262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	26216282	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36398072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	32733633, 37479698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	1378365, 27706780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29487871		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22508288, 29207094, 30688264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16327982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	28919237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10333719, 17056573	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17056573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	34962102, 7519822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	37295816	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	34741638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	28764810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone Marrow Neoplasms	BEFREE	22879387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	31827714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29290808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31282941	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17167725, 22014578, 22137794, 23679262, 24583847, 26872904, 28534212, 30389659, 31340603, 31344266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10880401, 19400944, 23613720, 27340107, 36800575, 37773178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	11106214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	LHGDN	15009098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	38620074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12854131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36359790	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	7537851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23396735, 24966965, 28473332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28272300, 31115506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28263384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29670110, 33178497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21068256, 25184692, 28235946, 37622107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26943029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16309209, 33588862, 35779918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19208843, 24029657, 28263384, 31186752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34593936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16332659, 20193033, 21600003, 24205197, 25175566, 25575156, 28202840, 29871496, 29936324, 30081225, 30132147, 30653588, 30771557, 31387411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	16332659, 25575156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17714716, 18666029		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24205197, 24699314, 25575156, 28646244, 30653588, 33050491, 33737636, 34346841, 36012132	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	24401216	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	18421029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29452833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	29052569, 35833818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	14615367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12393616, 14615367, 24075742, 25175566, 27814292, 28916665, 31147725, 31822249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	12393616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	19632255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	25175566, 28476896, 29096697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28476896	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	11309161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36828890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	21224055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	28851649		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis of pregnancy	Cholestasis of pregnancy	CTD_human_DG	28851649		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	12587980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	24975661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	33246119	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	31370809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26408929, 29048463, 31386888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19715592, 20335218, 27637890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	27391418, 29641752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	27391418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	10086854, 8609252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	17189405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29792953, 31086348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33720880, 36459652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20008145, 21034812, 30804723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	7541009	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18084318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25275062, 28495508, 9495363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18084316, 18084318, 29188362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	28949989, 29052569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31778438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17189405, 22429968, 28235946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28131673, 28675064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12940514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18420209, 24699314, 34320932, 36928188, 37060905, 9626834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25890092	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27885839, 28131673, 28675064, 29723873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32007502, 34850451, 34861059, 39344313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28131673, 28675064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	22028906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22028906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28221249, 31711925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	7541009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	LHGDN	15710215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29519923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	28821422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28646244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	28646244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29409258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	30582899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10447928, 23185512, 23313051, 24582795, 28664830, 31037360, 31196179, 8824717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21172429, 26289958, 30054439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28594820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	10086854, 27206134	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	20065994		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	CTD_human_DG	27206134		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	Pubtator	30510068	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	20065994, 30132823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	7686190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	22740338, 8800304, 9099932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	22740338, 26628598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18093596, 20856927, 28772214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31061324	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18093596, 20856927, 25303153, 28061383, 28675064, 28772214, 30498345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20111020, 25287126, 40065310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34506229	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	27406064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	10868972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20111020	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29025405	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26122942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	11935152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20111020, 26872904, 27323139, 28567668, 28641786, 28667102, 28807051, 28946194, 29025405, 29636047, 30716657, 30871567, 31456040, 31659242, 9562351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29854824, 34506229, 35991124, 36949528, 38174742, 39510044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29854824, 30632070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	15666579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28632765, 28931763, 29133026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	38172172	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	29992743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	17714716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	20856927, 28177698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20065994, 30132823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	21172429, 28481289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	11963839, 17678915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17678915, 28333208, 30395261, 31443713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31443713, 35616875, 36660246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	21502805, 37548395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	28584245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	19796194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31572289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28263384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33323552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25897102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eyelid Diseases	Eyelid disease	Pubtator	20220050	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	LHGDN	18707907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial intrahepatic cholestasis of pregnancy	Cholestasis of pregnancy	CTD_human_DG	28851649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	32714978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	26690142		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	26690142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30854694, 31132306, 31291245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28461687		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	26690142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	12854131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	34471638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	10643715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	31573481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24045955, 24787244, 28459461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24045955, 28365151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24045955, 24787244, 28459461, 30322656, 31207928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23593320, 24787244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28459461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	18574676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	8675737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	9551397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	8675737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	1370927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31300420	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	9731077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	29850964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	1378365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23242661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33498689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	9158103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	31759089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31778438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34593936, 37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Injuries	Cardiac injury	Pubtator	26173590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	26172478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	33954832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30181379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	30597709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	20193033		★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary hypertension	High altitude pulmonary edema	BEFREE	30254217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1605306, 22457206, 9722296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	17189405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalciuria Absorptive 2	Hypercalciuria	Pubtator	27161247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	11755917, 20856927, 28280218, 7504883		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	14602771		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	18825362, 20185810, 20856927, 26455386, 28754590, 30049285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	20592773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	11254667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10525665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	18582564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	20856927, 23107714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	34962102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	18383329, 37955024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	11834524, 19018797		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	23337395, 28699284, 29936324, 30065083		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	21030716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30264480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10477680, 28235946, 37071849	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29687288, 31637717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26386411		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30880546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35056403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29792953, 31086348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11106568, 27552332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21034812, 27552332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34561227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	20065994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28272703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	29052569	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17702963, 29723873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	11295083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	27123929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	7692824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	16156864, 38174742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17560459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29325582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	33574979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	17189405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	25754690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	27706378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11264180, 18024794, 22207686, 33127669, 7694686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28045930, 28266575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28045930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16453001, 28110427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	14551137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	14551137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	28294475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	17270454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	26289958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	30904046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	22922871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18482273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	16156864, 28473332, 35246921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	33954832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35726350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10329599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32691471	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29687288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22266541, 34427969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30268079, 30510068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24083390, 30510068	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24699314, 27211902, 7521807, 7694552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35332100	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30268079, 30510068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17964973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29096830, 29325582, 30157717, 30268079, 30510068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25554644, 26016809, 29076253, 29325582, 30712490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30268079, 30510068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12854131, 25450269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31713298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	23613720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	37653176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	1373268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22279054, 7691638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12028024	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35965624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19533685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35370941	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Maculopathy with diabetes mellitus	Diabetic maculopathy	BEFREE	12388172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28340040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	8774481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17167725, 22014578, 22137794, 23679262, 24583847, 26872904, 28534212, 31340603, 31344266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20193033, 28473332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28272300, 31115506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19208843, 24029657, 31186752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25277191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12854131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22014578, 22879387, 23593320, 24045955, 29614819, 29670110, 31521051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18084318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31347485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31398886	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12172576, 17167725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	22508288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	29188362		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	1281617, 20181932, 21129359, 29222169, 29519923, 30389659, 30660359, 7528140, 7530765, 8824559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	1281617, 1370233, 20181932, 21061269, 21129359, 35188342, 37240247, 7525548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17352405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20406964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28594820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	8774481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18761738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30008151, 31349950, 31827714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	28675064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31476158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30953065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	40176604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	15608947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	17456996, 28069066, 28587423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	17456996, 28069066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	22508288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10606891, 11154207, 25341809, 30736330, 32526706, 38280104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11494147, 19282458, 22427205, 24839982, 25962684, 30736330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	19057841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	20175758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	24686948	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25774903, 28919237, 31068198		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	25774903, 28919237	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	24686948	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	25774903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	20175758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	28984166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	32157826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30202063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	1281618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18078450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	25413339	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26662939, 28628621, 30317569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	21808112	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27816305		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	Pubtator	19353432, 9099932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	32259312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28940978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17063735, 9893189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	18629784, 8876553, 9176402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30659926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30659926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11243852, 11334881, 12854131, 17189405, 17405903, 21874229, 22879387, 23679262, 24029657, 24583847, 26872904, 27549123, 28178689, 28263384, 28459466 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	18656701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	34506229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25973900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32733633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28461687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28535543, 30197681, 30355915, 7519825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29228174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19249917, 21481180	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24582795, 27853845, 28414311, 29244802, 31387411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30572569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17900349, 31146598, 31812161, 35743247, 9099936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32384383	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	31037360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29789783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23720361, 32847038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29909077		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19208843, 24029657, 31186752		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19208843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	17189405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29670110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31760766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29670110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Acute Necrotizing	Pancreatitis	Pubtator	8675737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28764810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	11197119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	36052089	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	24681779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	24681779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24385196, 29947088, 31068198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31068198, 32733633, 40176604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	22863916, 24788225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	18227384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27391418, 29641752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	27391418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27391418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27391418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30535754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30535754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	25287126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	25287126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22018827, 30984117, 31456040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23898913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35551681	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	40507944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	29096830, 30953065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	16421949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28778657, 29157934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	21172429, 26289958, 30054439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16938647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	27161247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	18834676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25277191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19041175	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25277191, 25683512, 26537072, 33569050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	16938647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	28940220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29228174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18029384, 24083390	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962, 33816621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29687288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	30254217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15011745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	29340037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17189405, 22429968, 28235946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29133026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	28931763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10447928, 10623863, 12296865, 12643440, 17009243, 17530710, 17922685, 19597294, 20039412, 20604932, 23632129, 25147926, 29487871, 29614819, 29882203 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12105209, 12643440, 17530710, 17963163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33966399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	9797497	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28942562		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	18029384, 24083390	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	37246768	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	10477399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29028771, 29565737, 29599080, 29601599, 29763440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	12393616, 8509947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	10403921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	29068581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	18321301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20065994, 20714794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	7686190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Ulcer	Skin ulcer	Pubtator	10086854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	27693879	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23923005, 30144067		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	20386338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16327982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16309209, 32441311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25450269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12854131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12854131, 22408359, 31886120, 32373959, 35936362, 37563649, 9529982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	16790997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	12393616, 21808112, 24075742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28030939, 29926382, 31121365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	12393616, 8509947		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12393616, 8509947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11014344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	27623446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29487871, 29687288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	16802373, 31573481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	34259105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia 1	Thrombocytopenia	Pubtator	20130240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	21808112	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25988387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25576172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31340603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31731625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	19912235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	15553846		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	28340040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	CTD_human_DG	17347482		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24666523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	12121561		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	9640196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	18190605, 25323856, 26008233, 26761204, 30871567, 35332100, 38195507, 40187599, 9152314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33954832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	9562351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	15805138, 20808962, 25413339, 33608030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	10027408, 18490752, 8565309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	LHGDN	15710215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	17943075, 30158835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	31573481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	10086854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	40599142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	27301862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	24428816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

VCAM1 (vascular cell adhesion molecule 1)