UTP3 (UTP3 small subunit processome component)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 57050
• Gene name: UTP3 small subunit processome component
• Gene symbol: UTP3
• Synonyms (NCBI Gene): CRL1, CRLZ1, SAS10
• Chromosome: 4
• Chromosome location: 4q13.3

miRNA Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031872	hsa-miR-16-5p	Proteomics	18668040
MIRT052864	hsa-miR-3620-3p	CLASH	23622248
MIRT1481314	hsa-miR-3146	CLIP-seq
MIRT1481315	hsa-miR-4639-5p	CLIP-seq
MIRT1481316	hsa-miR-548ae	CLIP-seq
MIRT1481317	hsa-miR-548aj	CLIP-seq
MIRT1481318	hsa-miR-548am	CLIP-seq
MIRT1481319	hsa-miR-548p	CLIP-seq
MIRT1481320	hsa-miR-548x	CLIP-seq
MIRT2144818	hsa-miR-4662a-3p	CLIP-seq
MIRT2144819	hsa-miR-4753-3p	CLIP-seq
MIRT2144820	hsa-miR-520d-5p	CLIP-seq
MIRT2144821	hsa-miR-524-5p	CLIP-seq
MIRT2144822	hsa-miR-586	CLIP-seq
MIRT2365136	hsa-miR-1323	CLIP-seq
MIRT2365137	hsa-miR-548a-3p	CLIP-seq
MIRT2365138	hsa-miR-548ac	CLIP-seq
MIRT2365139	hsa-miR-548d-3p	CLIP-seq
MIRT2365140	hsa-miR-548e	CLIP-seq
MIRT2365141	hsa-miR-548f	CLIP-seq
MIRT2365142	hsa-miR-548o	CLIP-seq
MIRT2365143	hsa-miR-548z	CLIP-seq
MIRT2365144	hsa-miR-640	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000462	Process	Maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	25416956, 30021884, 32296183, 33961781, 39251607
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0032040	Component	Small-subunit processome	IBA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797

Other IDs

• MIM: 611614
• HGNC: 24477
• e!Ensembl: ENSG00000132467

Protein

• UniProt ID: Q9NQZ2
• Protein name: Something about silencing protein 10 (Charged amino acid-rich leucine zipper 1) (CRL1) (Disrupter of silencing SAS10) (UTP3 homolog)
• Protein function: Essential for gene silencing: has a role in the structure of silenced chromatin. Plays a role in the developing brain (By similarity). Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During
• PDB: 7MQ8 , 7MQ9 , 7MQA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04000	Sas10_Utp3	230 → 310	Sas10/Utp3/C1D family	Family
  PF09368	Sas10	405 → 478	Sas10 C-terminal domain	Domain

• Sequence:

  MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAAL
  AKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAE
  ASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDD
  FGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEV
  KDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIER
  LVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACA
  VTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRG
  LTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK

• Sequence length: 479

Pathways

Reactome Pathway:

Major pathway of rRNA processing in the nucleolus and cytosol

Related Genes

No strongly related genes found yet for UTP3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to UTP3.