Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51118
Gene name	UTP11 small subunit processome component
Gene symbol	UTP11
Synonyms (NCBI Gene)	CGI-94CGI94UTP11L
Chromosome	1
Chromosome location	1p34.3

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	12559088, 25416956
GO:0005615	Component	Extracellular space	IDA	11860508
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	11860508
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	11860508
GO:0005829	Component	Cytosol	IDA
GO:0006364	Process	RRNA processing	IEA
GO:0007399	Process	Nervous system development	IMP	12559088
GO:0032040	Component	Small-subunit processome	IBA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0032040	Component	Small-subunit processome	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797
GO:0043065	Process	Positive regulation of apoptotic process	IMP	12559088

MIM	HGNC	e!Ensembl
609440	24329	ENSG00000183520

Q9Y3A2

Protein name

Probable U3 small nucleolar RNA-associated protein 11 (U3 snoRNA-associated protein 11) (UTP11-like protein)

Protein function

Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associat

PDB

7MQ8 , 7MQ9 , 7MQA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03998	Utp11	13 → 253	Utp11 protein	Family

Sequence

MAAAFRKAAKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKALE
KNPDEFYYKMTRVKLQDGVHIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLK
SELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVK
GVTNQTGLKRIAKERQKQYNCLTQRIEREKKLFVIAQKIQTRKDLMDKTQKVKVKKETVN
SPAIYKFQSRRKR

Sequence length

253

Interactions

View interactions

Reactome Pathway
Major pathway of rRNA processing in the nucleolus and cytosol

Related Genes Genes most often co-reported with UTP11 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for UTP11.

Diseases Linked via Similar Genes Diseases curated for genes most similar to UTP11 (see Related Genes above), that are NOT already directly curated for UTP11 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to UTP11.

UTP11 (UTP11 small subunit processome component)

Bookmark This Gene