UTF1 (undifferentiated embryonic cell transcription factor 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8433
Gene name Undifferentiated embryonic cell transcription factor 1
Gene symbol UTF1
Synonyms (NCBI Gene)
-
Chromosome 10
Chromosome location 10q26.3
Summary The protein encoded by this gene is a leucine zipper-containing transcriptional coactivator that may link the upstream activator ATF2 with the basal transcription complex. The encoded protein is closely associated with chromatin and is required for the pr
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IDA 9748258
GO:0003713 Function Transcription coactivator activity TAS 9748258
GO:0005515 Function Protein binding IPI 9748258, 32296183
GO:0005634 Component Nucleus IC 9748258
GO:0005634 Component Nucleus IDA 18281244
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604130 12634 ENSG00000171794
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T230
Protein name Undifferentiated embryonic cell transcription factor 1
Protein function Acts as a transcriptional coactivator of ATF2.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13837 Myb_DNA-bind_4 60 → 140 Domain
Sequence 
MLLRPRRPPPLAPPAPPSPASPDPEPRTPGDAPGTPPRRPASPSALGELGLPVSPGSAQR
TPWSARETELLLGTLLQPAVWRALLLDRRQALPTYRRVSAALAQQQVRRTPAQCRRRYKF
LKDKFREAHGQPPGPFDEQIRKLMGLLGDNGRKRPRRRSPGSGRPQRARRPVPNAHAPAP
SEPDATPLPTARDRDADPTWTLRFSPSPPKSADASPAPGSPPAPAPTALATCIPEDRAPV
RGPGSPPPPPAREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL
LTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVLRDPCQ
Sequence length 341
Interactions View interactions

No strongly related genes found yet for UTF1.

No additional diseases found yet through genes similar to UTF1.