USP36 (ubiquitin specific peptidase 36)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57602
• Gene name: Ubiquitin specific peptidase 36
• Gene symbol: USP36
• Synonyms (NCBI Gene): DUB1
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: This gene encodes a member of the peptidase C19 or ubiquitin-specific protease family of cysteine proteases. Members of this family remove ubiquitin molecules from polyubiquitinated proteins. The encoded protein may deubiquitinate and stabilize the transc

miRNA Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027793	hsa-miR-98-5p	Microarray	19088304
MIRT043617	hsa-miR-151a-3p	CLASH	23622248
MIRT040098	hsa-miR-615-3p	CLASH	23622248
MIRT038207	hsa-miR-342-5p	CLASH	23622248
MIRT451787	hsa-miR-3154	PAR-CLIP	23592263
MIRT451785	hsa-miR-4499	PAR-CLIP	23592263
MIRT451786	hsa-miR-9500	PAR-CLIP	23592263
MIRT451784	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT451783	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT451782	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT451781	hsa-miR-101-5p	PAR-CLIP	23592263
MIRT451780	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT451779	hsa-miR-6080	PAR-CLIP	23592263
MIRT451778	hsa-miR-7515	PAR-CLIP	23592263
MIRT451777	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT451776	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT451775	hsa-miR-6124	PAR-CLIP	23592263
MIRT451774	hsa-miR-6077	PAR-CLIP	23592263
MIRT451773	hsa-miR-4434	PAR-CLIP	23592263
MIRT451772	hsa-miR-4516	PAR-CLIP	23592263
MIRT451771	hsa-miR-5703	PAR-CLIP	23592263
MIRT451770	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT451769	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT451768	hsa-miR-4531	PAR-CLIP	23592263
MIRT451787	hsa-miR-3154	PAR-CLIP	23592263
MIRT451785	hsa-miR-4499	PAR-CLIP	23592263
MIRT451786	hsa-miR-9500	PAR-CLIP	23592263
MIRT451784	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT451783	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT451782	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT451781	hsa-miR-101-5p	PAR-CLIP	23592263
MIRT451780	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT451779	hsa-miR-6080	PAR-CLIP	23592263
MIRT451778	hsa-miR-7515	PAR-CLIP	23592263
MIRT451777	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT451776	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT451775	hsa-miR-6124	PAR-CLIP	23592263
MIRT451774	hsa-miR-6077	PAR-CLIP	23592263
MIRT451773	hsa-miR-4434	PAR-CLIP	23592263
MIRT451772	hsa-miR-4516	PAR-CLIP	23592263
MIRT451771	hsa-miR-5703	PAR-CLIP	23592263
MIRT451770	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT451769	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT451768	hsa-miR-4531	PAR-CLIP	23592263
MIRT1479289	hsa-miR-1207-5p	CLIP-seq
MIRT1479290	hsa-miR-1237	CLIP-seq
MIRT1479291	hsa-miR-1279	CLIP-seq
MIRT1479292	hsa-miR-1302	CLIP-seq
MIRT1479293	hsa-miR-134	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479295	hsa-miR-153	CLIP-seq
MIRT1479296	hsa-miR-188-3p	CLIP-seq
MIRT1479297	hsa-miR-2052	CLIP-seq
MIRT1479298	hsa-miR-224	CLIP-seq
MIRT1479299	hsa-miR-2276	CLIP-seq
MIRT1479300	hsa-miR-298	CLIP-seq
MIRT1479301	hsa-miR-300	CLIP-seq
MIRT1479302	hsa-miR-31	CLIP-seq
MIRT1479303	hsa-miR-3118	CLIP-seq
MIRT1479304	hsa-miR-3120-3p	CLIP-seq
MIRT1479305	hsa-miR-3122	CLIP-seq
MIRT1479306	hsa-miR-3128	CLIP-seq
MIRT1479307	hsa-miR-3149	CLIP-seq
MIRT1479308	hsa-miR-3153	CLIP-seq
MIRT1479309	hsa-miR-3158-5p	CLIP-seq
MIRT1479310	hsa-miR-3169	CLIP-seq
MIRT1479311	hsa-miR-329	CLIP-seq
MIRT1479312	hsa-miR-3613-3p	CLIP-seq
MIRT1479313	hsa-miR-3620	CLIP-seq
MIRT1479314	hsa-miR-362-3p	CLIP-seq
MIRT1479315	hsa-miR-3667-3p	CLIP-seq
MIRT1479316	hsa-miR-3692	CLIP-seq
MIRT1479317	hsa-miR-376c	CLIP-seq
MIRT1479318	hsa-miR-381	CLIP-seq
MIRT1479319	hsa-miR-3913-5p	CLIP-seq
MIRT1479320	hsa-miR-3925-3p	CLIP-seq
MIRT1479321	hsa-miR-3941	CLIP-seq
MIRT1479322	hsa-miR-4261	CLIP-seq
MIRT1479323	hsa-miR-4269	CLIP-seq
MIRT1479324	hsa-miR-4298	CLIP-seq
MIRT1479325	hsa-miR-4307	CLIP-seq
MIRT1479326	hsa-miR-4330	CLIP-seq
MIRT1479327	hsa-miR-4424	CLIP-seq
MIRT1479328	hsa-miR-4444	CLIP-seq
MIRT1479329	hsa-miR-4459	CLIP-seq
MIRT1479330	hsa-miR-4477a	CLIP-seq
MIRT1479331	hsa-miR-448	CLIP-seq
MIRT1479332	hsa-miR-4496	CLIP-seq
MIRT1479333	hsa-miR-4515	CLIP-seq
MIRT1479334	hsa-miR-4639-5p	CLIP-seq
MIRT1479335	hsa-miR-4642	CLIP-seq
MIRT1479336	hsa-miR-4643	CLIP-seq
MIRT1479337	hsa-miR-4666-3p	CLIP-seq
MIRT1479338	hsa-miR-4668-5p	CLIP-seq
MIRT1479339	hsa-miR-4688	CLIP-seq
MIRT1479340	hsa-miR-4695-5p	CLIP-seq
MIRT1479341	hsa-miR-4700-3p	CLIP-seq
MIRT1479342	hsa-miR-4715-5p	CLIP-seq
MIRT1479343	hsa-miR-4729	CLIP-seq
MIRT1479344	hsa-miR-4736	CLIP-seq
MIRT1479345	hsa-miR-4742-3p	CLIP-seq
MIRT1479346	hsa-miR-4763-3p	CLIP-seq
MIRT1479347	hsa-miR-4772-3p	CLIP-seq
MIRT1479348	hsa-miR-4786-3p	CLIP-seq
MIRT1479349	hsa-miR-4789-5p	CLIP-seq
MIRT1479350	hsa-miR-485-5p	CLIP-seq
MIRT1479351	hsa-miR-486-5p	CLIP-seq
MIRT1479352	hsa-miR-494	CLIP-seq
MIRT1479353	hsa-miR-526b	CLIP-seq
MIRT1479354	hsa-miR-544	CLIP-seq
MIRT1479355	hsa-miR-548v	CLIP-seq
MIRT1479356	hsa-miR-587	CLIP-seq
MIRT1479357	hsa-miR-603	CLIP-seq
MIRT1479358	hsa-miR-642b	CLIP-seq
MIRT1479359	hsa-miR-665	CLIP-seq
MIRT1479360	hsa-miR-671-5p	CLIP-seq
MIRT1479361	hsa-miR-766	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479301	hsa-miR-300	CLIP-seq
MIRT2144320	hsa-miR-3155	CLIP-seq
MIRT2144321	hsa-miR-3155b	CLIP-seq
MIRT1479310	hsa-miR-3169	CLIP-seq
MIRT1479312	hsa-miR-3613-3p	CLIP-seq
MIRT1479317	hsa-miR-376c	CLIP-seq
MIRT1479318	hsa-miR-381	CLIP-seq
MIRT1479323	hsa-miR-4269	CLIP-seq
MIRT1479327	hsa-miR-4424	CLIP-seq
MIRT2144322	hsa-miR-4438	CLIP-seq
MIRT1479333	hsa-miR-4515	CLIP-seq
MIRT2144323	hsa-miR-4649-3p	CLIP-seq
MIRT1479337	hsa-miR-4666-3p	CLIP-seq
MIRT1479341	hsa-miR-4700-3p	CLIP-seq
MIRT1479343	hsa-miR-4729	CLIP-seq
MIRT2144324	hsa-miR-4738-5p	CLIP-seq
MIRT1479348	hsa-miR-4786-3p	CLIP-seq
MIRT1479349	hsa-miR-4789-5p	CLIP-seq
MIRT2144325	hsa-miR-484	CLIP-seq
MIRT1479353	hsa-miR-526b	CLIP-seq
MIRT1479360	hsa-miR-671-5p	CLIP-seq
MIRT2144326	hsa-miR-922	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2364485	hsa-miR-124	CLIP-seq
MIRT2364486	hsa-miR-1253	CLIP-seq
MIRT2364487	hsa-miR-1254	CLIP-seq
MIRT2364488	hsa-miR-1301	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479296	hsa-miR-188-3p	CLIP-seq
MIRT1479299	hsa-miR-2276	CLIP-seq
MIRT2364489	hsa-miR-25	CLIP-seq
MIRT2364490	hsa-miR-2964a-5p	CLIP-seq
MIRT2364491	hsa-miR-3116	CLIP-seq
MIRT1479304	hsa-miR-3120-3p	CLIP-seq
MIRT1479306	hsa-miR-3128	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2364493	hsa-miR-32	CLIP-seq
MIRT1479311	hsa-miR-329	CLIP-seq
MIRT1479314	hsa-miR-362-3p	CLIP-seq
MIRT2364494	hsa-miR-363	CLIP-seq
MIRT2364495	hsa-miR-367	CLIP-seq
MIRT1479321	hsa-miR-3941	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT2364497	hsa-miR-3978	CLIP-seq
MIRT1479326	hsa-miR-4330	CLIP-seq
MIRT2364498	hsa-miR-4470	CLIP-seq
MIRT2364499	hsa-miR-4660	CLIP-seq
MIRT2364500	hsa-miR-4690-3p	CLIP-seq
MIRT2364501	hsa-miR-4708-3p	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2364503	hsa-miR-4740-3p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT1479349	hsa-miR-4789-5p	CLIP-seq
MIRT2364505	hsa-miR-5047	CLIP-seq
MIRT2364506	hsa-miR-506	CLIP-seq
MIRT1479355	hsa-miR-548v	CLIP-seq
MIRT1479357	hsa-miR-603	CLIP-seq
MIRT2364507	hsa-miR-875-3p	CLIP-seq
MIRT2364508	hsa-miR-92a	CLIP-seq
MIRT2364509	hsa-miR-92b	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT1479325	hsa-miR-4307	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2658355	hsa-miR-1224-5p	CLIP-seq
MIRT2658356	hsa-miR-1236	CLIP-seq
MIRT2658357	hsa-miR-1245b-3p	CLIP-seq
MIRT1479291	hsa-miR-1279	CLIP-seq
MIRT2658358	hsa-miR-1293	CLIP-seq
MIRT2658359	hsa-miR-1296	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479295	hsa-miR-153	CLIP-seq
MIRT1479305	hsa-miR-3122	CLIP-seq
MIRT1479308	hsa-miR-3153	CLIP-seq
MIRT1479310	hsa-miR-3169	CLIP-seq
MIRT2658360	hsa-miR-3179	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2658361	hsa-miR-3202	CLIP-seq
MIRT1479312	hsa-miR-3613-3p	CLIP-seq
MIRT2658362	hsa-miR-3652	CLIP-seq
MIRT1479319	hsa-miR-3913-5p	CLIP-seq
MIRT2658363	hsa-miR-3936	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT1479322	hsa-miR-4261	CLIP-seq
MIRT2658364	hsa-miR-4303	CLIP-seq
MIRT2658365	hsa-miR-4430	CLIP-seq
MIRT1479328	hsa-miR-4444	CLIP-seq
MIRT2658366	hsa-miR-4457	CLIP-seq
MIRT2658367	hsa-miR-4476	CLIP-seq
MIRT1479331	hsa-miR-448	CLIP-seq
MIRT2658368	hsa-miR-4483	CLIP-seq
MIRT1479332	hsa-miR-4496	CLIP-seq
MIRT2658369	hsa-miR-4505	CLIP-seq
MIRT2658370	hsa-miR-4512	CLIP-seq
MIRT1479333	hsa-miR-4515	CLIP-seq
MIRT1479334	hsa-miR-4639-5p	CLIP-seq
MIRT2144323	hsa-miR-4649-3p	CLIP-seq
MIRT2658371	hsa-miR-4664-5p	CLIP-seq
MIRT1479338	hsa-miR-4668-5p	CLIP-seq
MIRT1479339	hsa-miR-4688	CLIP-seq
MIRT1479341	hsa-miR-4700-3p	CLIP-seq
MIRT2658372	hsa-miR-4719	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2658373	hsa-miR-4751	CLIP-seq
MIRT2658374	hsa-miR-4753-5p	CLIP-seq
MIRT2658375	hsa-miR-4762-3p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT1479348	hsa-miR-4786-3p	CLIP-seq
MIRT2658376	hsa-miR-486-3p	CLIP-seq
MIRT1479352	hsa-miR-494	CLIP-seq
MIRT2658377	hsa-miR-513b	CLIP-seq
MIRT2658378	hsa-miR-516a-5p	CLIP-seq
MIRT1479356	hsa-miR-587	CLIP-seq
MIRT2658379	hsa-miR-615-5p	CLIP-seq
MIRT1479360	hsa-miR-671-5p	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2658355	hsa-miR-1224-5p	CLIP-seq
MIRT2658356	hsa-miR-1236	CLIP-seq
MIRT2658358	hsa-miR-1293	CLIP-seq
MIRT2658359	hsa-miR-1296	CLIP-seq
MIRT2658360	hsa-miR-3179	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2658361	hsa-miR-3202	CLIP-seq
MIRT2658362	hsa-miR-3652	CLIP-seq
MIRT2658363	hsa-miR-3936	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT2658364	hsa-miR-4303	CLIP-seq
MIRT2658365	hsa-miR-4430	CLIP-seq
MIRT1479328	hsa-miR-4444	CLIP-seq
MIRT2658366	hsa-miR-4457	CLIP-seq
MIRT2658367	hsa-miR-4476	CLIP-seq
MIRT2658368	hsa-miR-4483	CLIP-seq
MIRT2658369	hsa-miR-4505	CLIP-seq
MIRT2658370	hsa-miR-4512	CLIP-seq
MIRT2144323	hsa-miR-4649-3p	CLIP-seq
MIRT2658371	hsa-miR-4664-5p	CLIP-seq
MIRT1479339	hsa-miR-4688	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2658373	hsa-miR-4751	CLIP-seq
MIRT2658374	hsa-miR-4753-5p	CLIP-seq
MIRT2658375	hsa-miR-4762-3p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT2658376	hsa-miR-486-3p	CLIP-seq
MIRT2658377	hsa-miR-513b	CLIP-seq
MIRT2658378	hsa-miR-516a-5p	CLIP-seq
MIRT1479356	hsa-miR-587	CLIP-seq
MIRT2658379	hsa-miR-615-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005515	Function	Protein binding	IPI	19615732, 25775507, 27445338, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	19208757, 25775507
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	27445338
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006325	Process	Chromatin organization	IMP	29274341
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007000	Process	Nucleolus organization	IEA
GO:0007000	Process	Nucleolus organization	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016242	Process	Negative regulation of macroautophagy	IMP	22622177
GO:0016579	Process	Protein deubiquitination	IDA	19208757, 25775507
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	IMP	27445338
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0031647	Process	Regulation of protein stability	IMP	27445338
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0140936	Function	Histone H2B deubiquitinase activity	IMP	29274341
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:1990380	Function	K48-linked deubiquitinase activity	IDA	35989368
GO:2000232	Process	Regulation of rRNA processing	IDA	19208757
GO:2000232	Process	Regulation of rRNA processing	IEA
GO:2000232	Process	Regulation of rRNA processing	ISS

Other IDs

• MIM: 612543
• HGNC: 20062
• e!Ensembl: ENSG00000055483

Protein

• UniProt ID: Q9P275
• Protein name: Ubiquitin carboxyl-terminal hydrolase 36 (EC 2.3.2.-) (EC 3.4.19.12) (Deubiquitinating enzyme 36) (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36)
• Protein function: Deubiquitinase essential for the regulation of nucleolar structure and function (PubMed:19208757, PubMed:22902402, PubMed:29273634). Required for cell and organism viability (PubMed:19208757, PubMed:22902402, PubMed:29273634). Plays an important
• PDB: 8BS3 , 8BS9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00443	UCH	122 → 420	Ubiquitin carboxyl-terminal hydrolase	Family

• Tissue specificity: TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:14715245}.
• Sequence:

  MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKY
  VLLNPKTEGASRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
  GAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFAN
  SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTL
  VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAY
  MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQNNG
  DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY
  LRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPH
  TTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPA
  PPQHFSPRTAQGLPGTSNSNSSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGND
  ESAGLDRRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTPPSGADS
  KTVKLKSPVLSNTTTEPASTMSPPPAKKLALSAKKASTLWRATGNDLRPPPPSPSSDLTH
  PMKTSHPVVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSSI
  STALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAP
  HGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQ
  VGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPLRHSCSPMGDGDPEAMEESPRKKKKKK
  RKQETQRAVEEDGHLKCPRSAKPQDAVVPESSSCAPSANGWCPGDRMGLSQAPPVSWNGE
  RESDVVQELLKYSSDKAYGRKVLTWDGKMSAVSQDAIEDSRQARTETVVDDWDEEFDRGK
  EKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSYRR

• Sequence length: 1123

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	33632238, 38062574, 41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	36376295, 40195560	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35551307, 38062574, 38685053, 39349817, 39379762	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	25775507, 36305548	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36239338, 36950067	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35748266	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39950338	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22865700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22865700		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36470870	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36239338	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30975468		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30975468		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18566677		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18566677	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28621160	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34526665	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for USP36.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to USP36.