Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	57663
Gene name	Ubiquitin specific peptidase 29
Gene symbol	USP29
Synonyms (NCBI Gene)	HOM-TES-84/86
Chromosome	19
Chromosome location	19q13.43

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016785	hsa-miR-335-5p	Microarray	18185580
MIRT1478562	hsa-miR-1200	CLIP-seq
MIRT1478563	hsa-miR-1298	CLIP-seq
MIRT1478564	hsa-miR-205	CLIP-seq
MIRT1478565	hsa-miR-4324	CLIP-seq
MIRT1478566	hsa-miR-4326	CLIP-seq
MIRT1478567	hsa-miR-4793-5p	CLIP-seq
MIRT1478568	hsa-miR-544b	CLIP-seq
MIRT2694815	hsa-miR-1228	CLIP-seq
MIRT2694816	hsa-miR-4711-5p	CLIP-seq
MIRT2694817	hsa-miR-544	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0002376	Process	Immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	ISS
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	10958632
GO:0005515	Function	Protein binding	IPI	38233848
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0051607	Process	Defense response to virus	ISS
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	ISS
GO:0071108	Process	Protein K48-linked deubiquitination	ISS
GO:0101005	Function	Deubiquitinase activity	IEA

MIM	HGNC	e!Ensembl
609546	18563	ENSG00000131864

Q9HBJ7

Protein name

Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.4.19.12) (Deubiquitinating enzyme 29) (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29)

Protein function

Deubiquitinase involved in innate antiviral immunity by mediating 'Lys-48'-linked deubiquitination of CGAS, thereby promoting its stabilization.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	285 → 882	Ubiquitin carboxyl-terminal hydrolase	Family
PF16674	UCH_N	1 → 105	N-terminal of ubiquitin carboxyl-terminal hydrolase 37	Domain

Sequence

MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSV
VLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVF
ESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTN
EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE
TVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAVL
QSLFAIPSFADDLLTQGVPWEYIPFEALIMTLTQLLALKDFCSTKIKRELLGNVKKVISA
VAEIFSGNMQNDAHEFLGQCLDQLKEDMEKLNATLNTGKECGDENSSPQMHVGSAATKVF
VCPVVANFEFELQLSLICKACGHAVLKVEPNNYLSINLHQETKPLPLSIQNSLDLFFKEE
ELEYNCQMCKQKSCVARHTFSRLSRVLIIHLKRYSFNNAWLLVKNNEQVYIPKSLSLSSY
CNESTKPPLPLSSSAPVGKCEVLEVSQEMISEINSPLTPSMKLTSESSDSLVLPVEPDKN
ADLQRFQRDCGDASQEQHQRDLENGSALESELVHFRDRAIGEKELPVADSLMDQGDISLP
VMYEDGGKLISSPDTRLVEVHLQEVPQHPELQKYEKTNTFVEFNFDSVTESTNGFYDCKE
NRIPEGSQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKAD
LNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMGDPLQAYRLISVVSHIGSSPNSGH
YISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSGYIFFYMHNGIFEELLRKAENSRL
PSTQAGVIPQGEYEGDSLYRPA

Sequence length

922

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	29228715	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	29691896	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34573430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37463886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36782089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with USP29 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for USP29.

Diseases Linked via Similar Genes Diseases curated for genes most similar to USP29 (see Related Genes above), that are NOT already directly curated for USP29 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to USP29.

USP29 (ubiquitin specific peptidase 29)

Bookmark This Gene