USP17L23 (ubiquitin specific peptidase 17 like family member 23)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 101241878
Gene name Ubiquitin specific peptidase 17 like family member 23
Gene symbol USP17L23
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4p16.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004843 Function Cysteine-type deubiquitinase activity IEA
GO:0005634 Component Nucleus IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0016579 Process Protein deubiquitination IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 44451 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
D6RBM5
Protein name Ubiquitin carboxyl-terminal hydrolase 17-like protein 23
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00443 UCH 80 → 182 Ubiquitin carboxyl-terminal hydrolase Family
Sequence 
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGH
KQV
Sequence length 183
Interactions View interactions

No strongly related genes found yet for USP17L23.

No additional diseases found yet through genes similar to USP17L23.