USP17L2 (ubiquitin specific peptidase 17 like family member 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 377630
• Gene name: Ubiquitin specific peptidase 17 like family member 2
• Gene symbol: USP17L2
• Synonyms (NCBI Gene): DUB-3, DUB3, USP17
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.[supplied by OMIM, Mar 2008]

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	20228808, 21239494
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	19188362, 20228808, 20368735
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	21239494
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21239494
GO:0005634	Component	Nucleus	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	19188362
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0010955	Process	Negative regulation of protein processing	IMP	19188362
GO:0016579	Process	Protein deubiquitination	IDA	20228808
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0030334	Process	Regulation of cell migration	IMP	21448158
GO:0031647	Process	Regulation of protein stability	IBA
GO:0034260	Process	Negative regulation of GTPase activity	IDA	19188362
GO:0042127	Process	Regulation of cell population proliferation	IMP	19188362
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043547	Process	Positive regulation of GTPase activity	IMP	21448158
GO:0050691	Process	Regulation of defense response to virus by host	IMP	20368735
GO:0070536	Process	Protein K63-linked deubiquitination	IMP	19188362, 20368735
GO:0071108	Process	Protein K48-linked deubiquitination	IMP	19188362, 20368735
GO:0071586	Process	CAAX-box protein processing	IMP	19188362
GO:0090315	Process	Negative regulation of protein targeting to membrane	IMP	19188362
GO:0110030	Process	Regulation of G2/MI transition of meiotic cell cycle	IMP	20228808
GO:1900027	Process	Regulation of ruffle assembly	IMP	21448158
GO:1900245	Process	Positive regulation of MDA-5 signaling pathway	IMP	20368735
GO:1900246	Process	Positive regulation of RIG-I signaling pathway	IMP	20368735

Other IDs

• MIM: 610186
• HGNC: 34434
• e!Ensembl: ENSG00000223443

Protein

• UniProt ID: Q6R6M4
• Protein name: Ubiquitin carboxyl-terminal hydrolase 17 (USP17) (EC 3.4.19.12) (Deubiquitinating enzyme 17-like protein 2) (Deubiquitinating protein 3) (DUB-3) (Ubiquitin carboxyl-terminal hydrolase 17-like protein 2) (Ubiquitin thioesterase 17-like protein 2) (Ubiquiti
• Protein function: Deubiquitinating enzyme that removes conjugated ubiquitin from specific proteins to regulate different cellular processes. Regulates cell proliferation by deubiquitinating and inhibiting RCE1 thereby controlling the small GTPases NRAS and HRAS l
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00443	UCH	80 → 372	Ubiquitin carboxyl-terminal hydrolase	Family

• Tissue specificity: TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:14699124}.
• Sequence:

  MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSSEARVDLCDDLAPVAR
  QLAPRKKLPLSSRRPAAVGAGLQNMGNTCYENASLQCLTYTPPLANYMLSREHSQTCQRP
  KCCMLCTMQAHITWALHSPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
  KQVDHHSKDTTLIHQIFGGCWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVKQALEQL
  VKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKLAKNVQYPEC
  LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHDGHYFSYVKAQEGQWYKMDDAKVTACSIT
  SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
  DERLVERATQESTLDHWKFPQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
  EQQSSLLNLSSTTRTDQESVNTGTLASLQGRTRRSKGKNKHSKRALLVCQ

• Sequence length: 530

Pathways

Reactome Pathway:

Ub-specific processing proteases

Related Genes

No strongly related genes found yet for USP17L2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to USP17L2.