Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	646625
Gene name	Ureidoimidazoline (2-oxo-4-hydroxy-4-carboxy-5-) decarboxylase
Gene symbol	URAD
Synonyms (NCBI Gene)	PRHOXNB
Chromosome	13
Chromosome location	13q12.2

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0000255	Process	Allantoin metabolic process	IEA
GO:0005777	Component	Peroxisome	IEA
GO:0006144	Process	Purine nucleobase metabolic process	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	ISS
GO:0019628	Process	Urate catabolic process	IBA
GO:0051997	Function	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase activity	IBA

MIM	HGNC	e!Ensembl
615804	17785	ENSG00000183463

A6NGE7

Protein name

Putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (OHCU decarboxylase) (EC 4.1.1.97) (Parahox neighbor) (Ureidoimidazoline (2-oxo-4-hydroxy-4-carboxy-5-) decarboxylase)

Protein function

Catalyzes the stereoselective decarboxylation of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU) to (S)-allantoin.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09349	OHCU_decarbox	7 → 163	OHCU decarboxylase	Domain

Tissue specificity

TISSUE SPECIFICITY: Apparently not expressed.

Sequence

MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQ
EGILRCHPDLAGSELQRGTLTAESQREQSGAGLRSLGADERLRLAELNAQYRARFGFPFV
LAARFSDRTAVPRELARRLLCPSAQELRTALGEVKKIGSLRLADLLRADPAKL

Sequence length

173

Interactions

View interactions

KEGG Pathway
Purine metabolism
Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34586374	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	33608531, 38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes Genes most often co-reported with URAD across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for URAD.

Diseases Linked via Similar Genes Diseases curated for genes most similar to URAD (see Related Genes above), that are NOT already directly curated for URAD itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to URAD.

URAD (ureidoimidazoline (2-oxo-4-hydroxy-4-carboxy-5-) decarboxylase)

Save This Analysis