Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	100128525
Gene name	Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 pseudogene 1
Gene symbol	UQCRFS1P1
Synonyms (NCBI Gene)	UQCRFSL1
Chromosome	22
Chromosome location	22q13.1

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	IBA
GO:0008121	Function	Quinol-cytochrome-c reductase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IBA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0045275	Component	Respiratory chain complex III	IBA
GO:0045275	Component	Respiratory chain complex III	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051537	Function	2 iron, 2 sulfur cluster binding	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
HGNC	12588	N/A

P0C7P4

Protein name

Putative cytochrome b-c1 complex subunit Rieske-like protein 1 (Ubiquinol-cytochrome c reductase Rieske iron-sulfur subunit pseudogene 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00355	Rieske	161 → 273	Rieske [2Fe-2S] domain	Domain
PF02921	UCR_TM	89 → 154	Ubiquinol cytochrome reductase transmembrane region	Family
PF09165	Ubiq-Cytc-red_N	11 → 85	Ubiquinol-cytochrome c reductase 8 kDa, N-terminal	Domain

Sequence

MQQIYTVKEIRSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLS
RESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESTEARK
GFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRG
KPLFVRHRTQKEIKQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDF
GGYYCPCHGSHYDASGRIRLGPATLNLEVPTYEFTSDDMVIVG

Sequence length

283

Interactions

View interactions

Related Genes Genes most often co-reported with UQCRFS1P1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for UQCRFS1P1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to UQCRFS1P1 (see Related Genes above), that are NOT already directly curated for UQCRFS1P1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to UQCRFS1P1.

UQCRFS1P1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 pseudogene 1)

Bookmark This Gene