UQCC4 (ubiquinol-cytochrome c reductase complex assembly factor 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283951
Gene name Ubiquinol-cytochrome c reductase complex assembly factor 4
Gene symbol UQCC4
Synonyms (NCBI Gene)
C16orf91CCSMST1URLC5gs103
Chromosome 16
Chromosome location 16p13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IBA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0005743 Component Mitochondrial inner membrane ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620578 27558 ENSG00000174109
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q4G0I0
Protein name Ubiquinol-cytochrome c reductase complex assembly factor 4 (Protein CCSMST1)
Protein function Required for the assembly and stability of the mitochondrial ubiquinol-cytochrome c reductase complex (complex III (CIII) or cytochrome b-c1 complex), a multisubunit transmembrane complex that is part of the mitochondrial electron transport chai
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15013 CCSMST1 47 → 119 CCSMST1 family Family
Sequence 
MNRVLCAPAAGAVRALRLIGWASRSLHPLPGSRDRAHPAAEEEDDPDRPIEFSSSKANPH
RWSVGHTMGKGHQRPWWKVLPLSCFLVALIIWCYLREESEADQWLRQVWGEVPEPSDRSE
EPETPAAYRART
Sequence length 132
Interactions View interactions

No strongly related genes found yet for UQCC4.

No additional diseases found yet through genes similar to UQCC4.