Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	105375355
Gene name	Uroplakin 3B
Gene symbol	UPK3B
Synonyms (NCBI Gene)	P35UP3BUPIIIB
Chromosome	7
Chromosome location	7q11.23
Summary	UPK3B is a minor component of the apical plaques of mammalian urothelium that binds and dimerizes with uroplakin-1b (UPK1B; MIM 602380), one of the major conserved urothelium membrane proteins. The other major conserved integral membrane proteins of uroth

254 Show/Hide all (254)

miRTarBase ID	miRNA	Experiments
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476356	hsa-miR-1207-5p	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT1476358	hsa-miR-1291	CLIP-seq
MIRT1476359	hsa-miR-1827	CLIP-seq
MIRT1476360	hsa-miR-1909	CLIP-seq
MIRT1476361	hsa-miR-2467-3p	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476364	hsa-miR-298	CLIP-seq
MIRT1476365	hsa-miR-3150a-3p	CLIP-seq
MIRT1476366	hsa-miR-3150b-3p	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476368	hsa-miR-3175	CLIP-seq
MIRT1476369	hsa-miR-3179	CLIP-seq
MIRT1476370	hsa-miR-3185	CLIP-seq
MIRT1476371	hsa-miR-328	CLIP-seq
MIRT1476372	hsa-miR-3652	CLIP-seq
MIRT1476373	hsa-miR-3664-3p	CLIP-seq
MIRT1476374	hsa-miR-3714	CLIP-seq
MIRT1476375	hsa-miR-4271	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT1476377	hsa-miR-4290	CLIP-seq
MIRT1476378	hsa-miR-4430	CLIP-seq
MIRT1476379	hsa-miR-4496	CLIP-seq
MIRT1476380	hsa-miR-4505	CLIP-seq
MIRT1476381	hsa-miR-4641	CLIP-seq
MIRT1476382	hsa-miR-4667-5p	CLIP-seq
MIRT1476383	hsa-miR-4690-5p	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476385	hsa-miR-4700-5p	CLIP-seq
MIRT1476386	hsa-miR-4705	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT1476388	hsa-miR-4725-3p	CLIP-seq
MIRT1476389	hsa-miR-4731-5p	CLIP-seq
MIRT1476390	hsa-miR-4763-3p	CLIP-seq
MIRT1476391	hsa-miR-4763-5p	CLIP-seq
MIRT1476392	hsa-miR-4784	CLIP-seq
MIRT1476393	hsa-miR-4786-5p	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT1476395	hsa-miR-548an	CLIP-seq
MIRT1476396	hsa-miR-583	CLIP-seq
MIRT1476397	hsa-miR-596	CLIP-seq
MIRT1476398	hsa-miR-873	CLIP-seq
MIRT1476399	hsa-miR-939	CLIP-seq
MIRT1476400	hsa-miR-940	CLIP-seq
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476356	hsa-miR-1207-5p	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT2143514	hsa-miR-138	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476364	hsa-miR-298	CLIP-seq
MIRT1476365	hsa-miR-3150a-3p	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476368	hsa-miR-3175	CLIP-seq
MIRT1476369	hsa-miR-3179	CLIP-seq
MIRT1476372	hsa-miR-3652	CLIP-seq
MIRT1476373	hsa-miR-3664-3p	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT1476378	hsa-miR-4430	CLIP-seq
MIRT2143515	hsa-miR-4455	CLIP-seq
MIRT1476380	hsa-miR-4505	CLIP-seq
MIRT2143516	hsa-miR-4514	CLIP-seq
MIRT2143517	hsa-miR-4645-5p	CLIP-seq
MIRT1476382	hsa-miR-4667-5p	CLIP-seq
MIRT2143518	hsa-miR-4673	CLIP-seq
MIRT2143519	hsa-miR-4692	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476385	hsa-miR-4700-5p	CLIP-seq
MIRT1476386	hsa-miR-4705	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT1476389	hsa-miR-4731-5p	CLIP-seq
MIRT1476390	hsa-miR-4763-3p	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT2143520	hsa-miR-544b	CLIP-seq
MIRT1476395	hsa-miR-548an	CLIP-seq
MIRT1476398	hsa-miR-873	CLIP-seq
MIRT1476399	hsa-miR-939	CLIP-seq
MIRT1476400	hsa-miR-940	CLIP-seq
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476364	hsa-miR-298	CLIP-seq
MIRT2363716	hsa-miR-3140-3p	CLIP-seq
MIRT1476365	hsa-miR-3150a-3p	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476368	hsa-miR-3175	CLIP-seq
MIRT2363717	hsa-miR-3176	CLIP-seq
MIRT1476369	hsa-miR-3179	CLIP-seq
MIRT2363718	hsa-miR-3622a-5p	CLIP-seq
MIRT1476372	hsa-miR-3652	CLIP-seq
MIRT1476373	hsa-miR-3664-3p	CLIP-seq
MIRT2363719	hsa-miR-3922-3p	CLIP-seq
MIRT2363720	hsa-miR-4269	CLIP-seq
MIRT1476375	hsa-miR-4271	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT1476378	hsa-miR-4430	CLIP-seq
MIRT1476379	hsa-miR-4496	CLIP-seq
MIRT1476380	hsa-miR-4505	CLIP-seq
MIRT1476382	hsa-miR-4667-5p	CLIP-seq
MIRT1476383	hsa-miR-4690-5p	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476385	hsa-miR-4700-5p	CLIP-seq
MIRT1476386	hsa-miR-4705	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT1476388	hsa-miR-4725-3p	CLIP-seq
MIRT1476389	hsa-miR-4731-5p	CLIP-seq
MIRT2363721	hsa-miR-4738-3p	CLIP-seq
MIRT2363722	hsa-miR-4781-3p	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT1476398	hsa-miR-873	CLIP-seq
MIRT1476399	hsa-miR-939	CLIP-seq
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT2143520	hsa-miR-544b	CLIP-seq
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT1476358	hsa-miR-1291	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476371	hsa-miR-328	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT1476377	hsa-miR-4290	CLIP-seq
MIRT1476381	hsa-miR-4641	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT1476391	hsa-miR-4763-5p	CLIP-seq
MIRT1476393	hsa-miR-4786-5p	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT1476397	hsa-miR-596	CLIP-seq
MIRT1476358	hsa-miR-1291	CLIP-seq
MIRT1476371	hsa-miR-328	CLIP-seq
MIRT1476377	hsa-miR-4290	CLIP-seq
MIRT1476381	hsa-miR-4641	CLIP-seq
MIRT1476391	hsa-miR-4763-5p	CLIP-seq
MIRT1476393	hsa-miR-4786-5p	CLIP-seq
MIRT1476397	hsa-miR-596	CLIP-seq
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT2657418	hsa-miR-185	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476364	hsa-miR-298	CLIP-seq
MIRT2363716	hsa-miR-3140-3p	CLIP-seq
MIRT1476365	hsa-miR-3150a-3p	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476368	hsa-miR-3175	CLIP-seq
MIRT2363717	hsa-miR-3176	CLIP-seq
MIRT1476369	hsa-miR-3179	CLIP-seq
MIRT2657419	hsa-miR-3187-3p	CLIP-seq
MIRT2657420	hsa-miR-3616-5p	CLIP-seq
MIRT2363718	hsa-miR-3622a-5p	CLIP-seq
MIRT2657421	hsa-miR-3647-5p	CLIP-seq
MIRT1476372	hsa-miR-3652	CLIP-seq
MIRT1476373	hsa-miR-3664-3p	CLIP-seq
MIRT2657422	hsa-miR-3689a-3p	CLIP-seq
MIRT2657423	hsa-miR-3689c	CLIP-seq
MIRT2363719	hsa-miR-3922-3p	CLIP-seq
MIRT2363720	hsa-miR-4269	CLIP-seq
MIRT1476375	hsa-miR-4271	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT2657424	hsa-miR-4306	CLIP-seq
MIRT1476378	hsa-miR-4430	CLIP-seq
MIRT2657425	hsa-miR-4446-3p	CLIP-seq
MIRT1476379	hsa-miR-4496	CLIP-seq
MIRT1476380	hsa-miR-4505	CLIP-seq
MIRT2657426	hsa-miR-4529-5p	CLIP-seq
MIRT2657427	hsa-miR-4644	CLIP-seq
MIRT1476382	hsa-miR-4667-5p	CLIP-seq
MIRT1476383	hsa-miR-4690-5p	CLIP-seq
MIRT2657428	hsa-miR-4693-3p	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476385	hsa-miR-4700-5p	CLIP-seq
MIRT1476386	hsa-miR-4705	CLIP-seq
MIRT2657429	hsa-miR-4716-5p	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT2657430	hsa-miR-4721	CLIP-seq
MIRT2657431	hsa-miR-4722-5p	CLIP-seq
MIRT1476388	hsa-miR-4725-3p	CLIP-seq
MIRT2657432	hsa-miR-4728-5p	CLIP-seq
MIRT1476389	hsa-miR-4731-5p	CLIP-seq
MIRT2363721	hsa-miR-4738-3p	CLIP-seq
MIRT2657433	hsa-miR-4768-3p	CLIP-seq
MIRT2363722	hsa-miR-4781-3p	CLIP-seq
MIRT2657434	hsa-miR-4795-5p	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT2657435	hsa-miR-573	CLIP-seq
MIRT1476398	hsa-miR-873	CLIP-seq
MIRT1476399	hsa-miR-939	CLIP-seq
MIRT1476354	hsa-miR-1184	CLIP-seq
MIRT1476355	hsa-miR-1205	CLIP-seq
MIRT1476357	hsa-miR-128	CLIP-seq
MIRT2657418	hsa-miR-185	CLIP-seq
MIRT1476362	hsa-miR-27a	CLIP-seq
MIRT1476363	hsa-miR-27b	CLIP-seq
MIRT1476364	hsa-miR-298	CLIP-seq
MIRT2363716	hsa-miR-3140-3p	CLIP-seq
MIRT1476365	hsa-miR-3150a-3p	CLIP-seq
MIRT1476367	hsa-miR-3158-5p	CLIP-seq
MIRT1476368	hsa-miR-3175	CLIP-seq
MIRT2363717	hsa-miR-3176	CLIP-seq
MIRT1476369	hsa-miR-3179	CLIP-seq
MIRT2657419	hsa-miR-3187-3p	CLIP-seq
MIRT2657420	hsa-miR-3616-5p	CLIP-seq
MIRT2363718	hsa-miR-3622a-5p	CLIP-seq
MIRT2657421	hsa-miR-3647-5p	CLIP-seq
MIRT1476372	hsa-miR-3652	CLIP-seq
MIRT2657422	hsa-miR-3689a-3p	CLIP-seq
MIRT2657423	hsa-miR-3689c	CLIP-seq
MIRT2363719	hsa-miR-3922-3p	CLIP-seq
MIRT2363720	hsa-miR-4269	CLIP-seq
MIRT1476375	hsa-miR-4271	CLIP-seq
MIRT1476376	hsa-miR-4277	CLIP-seq
MIRT2657424	hsa-miR-4306	CLIP-seq
MIRT1476378	hsa-miR-4430	CLIP-seq
MIRT2657425	hsa-miR-4446-3p	CLIP-seq
MIRT1476380	hsa-miR-4505	CLIP-seq
MIRT2657426	hsa-miR-4529-5p	CLIP-seq
MIRT2657427	hsa-miR-4644	CLIP-seq
MIRT1476382	hsa-miR-4667-5p	CLIP-seq
MIRT1476383	hsa-miR-4690-5p	CLIP-seq
MIRT2657428	hsa-miR-4693-3p	CLIP-seq
MIRT1476384	hsa-miR-4700-3p	CLIP-seq
MIRT1476385	hsa-miR-4700-5p	CLIP-seq
MIRT1476386	hsa-miR-4705	CLIP-seq
MIRT2657429	hsa-miR-4716-5p	CLIP-seq
MIRT1476387	hsa-miR-4718	CLIP-seq
MIRT2657430	hsa-miR-4721	CLIP-seq
MIRT2657431	hsa-miR-4722-5p	CLIP-seq
MIRT1476388	hsa-miR-4725-3p	CLIP-seq
MIRT2657432	hsa-miR-4728-5p	CLIP-seq
MIRT1476389	hsa-miR-4731-5p	CLIP-seq
MIRT2657433	hsa-miR-4768-3p	CLIP-seq
MIRT2363722	hsa-miR-4781-3p	CLIP-seq
MIRT2657434	hsa-miR-4795-5p	CLIP-seq
MIRT1476394	hsa-miR-544	CLIP-seq
MIRT2657435	hsa-miR-573	CLIP-seq
MIRT1476399	hsa-miR-939	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005886	Component	Plasma membrane	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	18776082
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
611887	21444	ENSG00000243566

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9BT76
Protein name	Uroplakin-3b (UP3b) (Uroplakin IIIb) (UPIIIb) (p35)
Protein function	Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells.
Family and domains
Sequence	MGLPWGQPHLGLQMLLLALNCLRPSLSLGEWGSWMDASSQTQGAGGPAGVIGPWAPAPLR LGEAAPGTPTPVSVAHLLSPVATELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLAS ASDTVWLVVAFSNASRGFQNPETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPMAGSGG APVLRVGHDHGCHQQPFCNAPLPGPGPYREDPRIHRHLARAAKWQHDRHYLHPLFSGRPP TLGLLGSLYHALLQPVVAGGGPGAAADRLLHGQALHDPPHPTQRGRHTAGGLQAWPGPPP QPQPLAWPLCMGLGEMGRWE
Sequence length	320
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (52)
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28912154	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11228158	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18205865	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22696682	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20603238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17493033, 30158515	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21544067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11118734, 9502407	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10593565, 12496451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	28912154	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	18075258	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	15175076	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	29731755	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18588867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31715265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24994465	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8656012	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21544067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26469698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10525320, 11014347, 12472178	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12153001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12153001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12153001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22696682	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20603238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21825040, 31472403	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20181942, 20603238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17145757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	26469698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15009685	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11358987, 12460909, 16763609, 16823838, 20603238, 28640256	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21338355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15485494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15307952, 17979810, 21844361, 24725413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	16525053	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20181942	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20603238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21825040, 31472403	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21825040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	11118734	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18588867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15123618	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29802736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31317786, 31788758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25697137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21772061	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	25878277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29535807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	22612807	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lissencephaly	Lissencephaly, X-Linked	BEFREE	10826984	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with UPK3B across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for UPK3B.

Diseases Linked via Similar Genes Diseases curated for genes most similar to UPK3B (see Related Genes above), that are NOT already directly curated for UPK3B itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to UPK3B.

UPK3B (uroplakin 3B)

Bookmark This Gene