UNC13C (unc-13 homolog C)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 440279
• Gene name: Unc-13 homolog C
• Gene symbol: UNC13C
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q21.3

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021903	hsa-miR-128-3p	Microarray	17612493
MIRT1475341	hsa-miR-2053	CLIP-seq
MIRT1475342	hsa-miR-3074-3p	CLIP-seq
MIRT1475343	hsa-miR-495	CLIP-seq
MIRT1475344	hsa-miR-507	CLIP-seq
MIRT1475345	hsa-miR-557	CLIP-seq
MIRT2143223	hsa-miR-1271	CLIP-seq
MIRT2143224	hsa-miR-182	CLIP-seq
MIRT2143225	hsa-miR-3145-3p	CLIP-seq
MIRT2143226	hsa-miR-3163	CLIP-seq
MIRT2143227	hsa-miR-412	CLIP-seq
MIRT2143228	hsa-miR-4310	CLIP-seq
MIRT2143229	hsa-miR-4659a-3p	CLIP-seq
MIRT2143230	hsa-miR-4659b-3p	CLIP-seq
MIRT2143231	hsa-miR-4775	CLIP-seq
MIRT2143232	hsa-miR-499-3p	CLIP-seq
MIRT2143233	hsa-miR-499a-3p	CLIP-seq
MIRT2143234	hsa-miR-590-3p	CLIP-seq
MIRT2143235	hsa-miR-96	CLIP-seq
MIRT2363525	hsa-miR-141	CLIP-seq
MIRT2363526	hsa-miR-200a	CLIP-seq
MIRT2143225	hsa-miR-3145-3p	CLIP-seq
MIRT2363527	hsa-miR-490-5p	CLIP-seq
MIRT2363528	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005516	Function	Calmodulin binding	IBA
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006887	Process	Exocytosis	IEA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IEA
GO:0016081	Process	Synaptic vesicle docking	IBA
GO:0016082	Process	Synaptic vesicle priming	IBA
GO:0017075	Function	Syntaxin-1 binding	IBA
GO:0019992	Function	Diacylglycerol binding	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0031594	Component	Neuromuscular junction	IBA
GO:0031914	Process	Negative regulation of synaptic plasticity	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA
GO:0042734	Component	Presynaptic membrane	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043195	Component	Terminal bouton	IBA
GO:0044305	Component	Calyx of Held	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048786	Component	Presynaptic active zone	TAS	15217342
GO:0061789	Process	Dense core granule priming	IBA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 614568
• HGNC: 23149
• e!Ensembl: ENSG00000137766

Protein

• UniProt ID: Q8NB66
• Protein name: Protein unc-13 homolog C (Munc13-3)
• Protein function: May play a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. May be involved in the regulation of synaptic transmission at parallel fiber - Purkinje cell synapses (By similarity). {ECO:00002
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00130	C1_1	1098 → 1150	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00168	C2	1220 → 1329	C2 domain	Domain
  PF00168	C2	2061 → 2171	C2 domain	Domain
  PF06292	DUF1041	1540 → 1646	Domain of Unknown Function (DUF1041)	Domain
  PF10540	Membr_traf_MHD	1887 → 2027	Munc13 (mammalian uncoordinated) homology domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Exclusively expressed in brain.
• Sequence:

  MVANFFKSLILPYIHKLCKGMFTKKLGNTNKNKEYRQQKKDQDFPTAGQTKSPKFSYTFK
  STVKKIAKCSSTHNLSTEEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
  SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
  LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
  DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
  ETRDIHDYIKHLGHMGSKASLRFLNVTEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
  QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
  IPSSQTYESMAIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLSKSELLTKGSTS
  KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
  FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
  PKDQHLNGGVQGIQGQTETENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
  NQGADLGLDSSTQEGFDYETNSLFDQQLDVYNKDLEYLGKCHSDLQDDSESYDLTQDDNS
  SPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYRSQSELQSDDSEDAPPKSWH
  SRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQST
  ANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITETDE
  QMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPEQPV
  EITKPKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQ
  VCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHV
  FKKTLQALIYPMSSTIPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQ
  DLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKEDF
  VQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIF
  GNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLS
  GEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSN
  GGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAV
  MSTLLANINAFYAHTTVSTNIQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYREN
  FPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIFDN
  CHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE
  LNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKD
  AVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSEHALFSCSVVDVFAQL
  NQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSHCDKENVPCILMNN
  IQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEECIKQ
  MSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSLSAKICEKTVLKRVLKELW
  KLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDARGLTPRQCAIMEV
  VLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRSSK
  DAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKKRK
  QGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIA
  EKGSYGAWYPLLKNISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEESA

• Sequence length: 2214

Pathways

KEGG Pathway:

Synaptic vesicle cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (26)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Abnormal finger morphology	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Abnormality of the face	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	27611488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	40962958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	40229280	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	40229280	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clubfoot	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CLUBFOOT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	35959094	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC DYSPLASIA OF KIDNEY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic renal dysplasia	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	40229280	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	38714721	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	34642315	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	26114229	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal cyst	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOSIS	—	GWAS catalog	33332786	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC CREUTZFELD JACOB DISEASE	—	GWAS catalog	39079175	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	34737425	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35473892, 37575271	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31440468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31440468		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31440468		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASDB_DG	17052657		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	26420894	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37575271	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

LGR6 3 shared diseasesEstrogen-receptor negative breast cancer, Post-traumatic stress disorder, Willis-ekbom disease 3 shared evidence sourcesGWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Post-traumatic stress disorder), GWAS catalog (Willis-ekbom disease) Related via 3 shared diseases including Estrogen-receptor negative breast cancer, Post-traumatic stress disorder — evidence mostly GWAS catalog. RSL24D1 2 shared diseasesEstrogen-receptor negative breast cancer, Inflammatory skin disease 2 shared evidence sourcesGWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Inflammatory skin disease) Related via 2 shared diseases including Estrogen-receptor negative breast cancer, Inflammatory skin disease — evidence mostly GWAS catalog. ZDHHC14 2 shared diseasesOropharyngeal cancer, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Oropharyngeal cancer), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Oropharyngeal cancer, Post-traumatic stress disorder — evidence mostly GWAS catalog. PHF21B 2 shared diseasesPost-traumatic stress disorder, Spondylosis 2 shared evidence sourcesGWAS catalog (Post-traumatic stress disorder), GWAS catalog (Spondylosis) Related via 2 shared diseases including Post-traumatic stress disorder, Spondylosis — evidence mostly GWAS catalog. ANAPC4 2 shared diseasesGestational diabetes, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gestational diabetes), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gestational diabetes, Post-traumatic stress disorder — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
LGR6	3	["Estrogen-receptor negative breast cancer","Post-traumatic stress disorder","Willis-ekbom disease"]	0	[]	3	["GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Willis-ekbom disease)"]
RSL24D1	2	["Estrogen-receptor negative breast cancer","Inflammatory skin disease"]	0	[]	2	["GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Inflammatory skin disease)"]
ZDHHC14	2	["Oropharyngeal cancer","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Oropharyngeal cancer)","GWAS catalog (Post-traumatic stress disorder)"]
PHF21B	2	["Post-traumatic stress disorder","Spondylosis"]	0	[]	2	["GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Spondylosis)"]
ANAPC4	2	["Gestational diabetes","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gestational diabetes)","GWAS catalog (Post-traumatic stress disorder)"]

Diseases Linked via Similar Genes

Breast neoplasms Linked via 1 of 5 related genesLGR6 Squamous cell carcinoma Linked via 1 of 5 related genesLGR6 Colorectal neoplasms Linked via 1 of 5 related genesLGR6 Myelodysplastic syndrome Linked via 1 of 5 related genesLGR6 Pernicious anemia Linked via 1 of 5 related genesLGR6

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Breast neoplasms	1	["LGR6"]
Squamous cell carcinoma	1	["LGR6"]
Colorectal neoplasms	1	["LGR6"]
Myelodysplastic syndrome	1	["LGR6"]
Pernicious anemia	1	["LGR6"]