Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	25989
Gene name	Unc-51 like kinase 3
Gene symbol	ULK3
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q24.1

173 Show/Hide all (173)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004992	hsa-miR-125b-5p	Microarray	17891175
MIRT037732	hsa-miR-744-5p	CLASH	23622248
MIRT439344	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT439344	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT1474881	hsa-miR-150	CLIP-seq
MIRT1474882	hsa-miR-181a	CLIP-seq
MIRT1474883	hsa-miR-181b	CLIP-seq
MIRT1474884	hsa-miR-181c	CLIP-seq
MIRT1474885	hsa-miR-181d	CLIP-seq
MIRT1474886	hsa-miR-2117	CLIP-seq
MIRT1474887	hsa-miR-302a	CLIP-seq
MIRT1474888	hsa-miR-302b	CLIP-seq
MIRT1474889	hsa-miR-302c	CLIP-seq
MIRT1474890	hsa-miR-302d	CLIP-seq
MIRT1474891	hsa-miR-302e	CLIP-seq
MIRT1474892	hsa-miR-3671	CLIP-seq
MIRT1474893	hsa-miR-371-5p	CLIP-seq
MIRT1474894	hsa-miR-371b-5p	CLIP-seq
MIRT1474895	hsa-miR-372	CLIP-seq
MIRT1474896	hsa-miR-373	CLIP-seq
MIRT1474897	hsa-miR-4262	CLIP-seq
MIRT1474898	hsa-miR-4273	CLIP-seq
MIRT1474899	hsa-miR-4290	CLIP-seq
MIRT1474900	hsa-miR-4436b-3p	CLIP-seq
MIRT1474901	hsa-miR-4477b	CLIP-seq
MIRT1474902	hsa-miR-4713-5p	CLIP-seq
MIRT1474903	hsa-miR-4722-3p	CLIP-seq
MIRT1474904	hsa-miR-512-3p	CLIP-seq
MIRT1474905	hsa-miR-520a-3p	CLIP-seq
MIRT1474906	hsa-miR-520b	CLIP-seq
MIRT1474907	hsa-miR-520c-3p	CLIP-seq
MIRT1474908	hsa-miR-520d-3p	CLIP-seq
MIRT1474909	hsa-miR-520e	CLIP-seq
MIRT1474910	hsa-miR-532-3p	CLIP-seq
MIRT2142932	hsa-miR-1298	CLIP-seq
MIRT1474881	hsa-miR-150	CLIP-seq
MIRT1474886	hsa-miR-2117	CLIP-seq
MIRT2142933	hsa-miR-24	CLIP-seq
MIRT1474887	hsa-miR-302a	CLIP-seq
MIRT1474888	hsa-miR-302b	CLIP-seq
MIRT1474889	hsa-miR-302c	CLIP-seq
MIRT1474890	hsa-miR-302d	CLIP-seq
MIRT1474891	hsa-miR-302e	CLIP-seq
MIRT2142934	hsa-miR-3065-3p	CLIP-seq
MIRT2142935	hsa-miR-3189-5p	CLIP-seq
MIRT1474892	hsa-miR-3671	CLIP-seq
MIRT2142936	hsa-miR-3675-5p	CLIP-seq
MIRT2142937	hsa-miR-371-3p	CLIP-seq
MIRT1474893	hsa-miR-371-5p	CLIP-seq
MIRT2142938	hsa-miR-371b-3p	CLIP-seq
MIRT1474894	hsa-miR-371b-5p	CLIP-seq
MIRT1474895	hsa-miR-372	CLIP-seq
MIRT1474896	hsa-miR-373	CLIP-seq
MIRT2142939	hsa-miR-3920	CLIP-seq
MIRT1474898	hsa-miR-4273	CLIP-seq
MIRT2142940	hsa-miR-4284	CLIP-seq
MIRT2142941	hsa-miR-4473	CLIP-seq
MIRT2142942	hsa-miR-4671-3p	CLIP-seq
MIRT1474902	hsa-miR-4713-5p	CLIP-seq
MIRT2142943	hsa-miR-4749-3p	CLIP-seq
MIRT2142944	hsa-miR-493	CLIP-seq
MIRT1474904	hsa-miR-512-3p	CLIP-seq
MIRT2142945	hsa-miR-515-3p	CLIP-seq
MIRT2142946	hsa-miR-519e	CLIP-seq
MIRT1474905	hsa-miR-520a-3p	CLIP-seq
MIRT1474906	hsa-miR-520b	CLIP-seq
MIRT1474907	hsa-miR-520c-3p	CLIP-seq
MIRT1474908	hsa-miR-520d-3p	CLIP-seq
MIRT1474909	hsa-miR-520e	CLIP-seq
MIRT1474910	hsa-miR-532-3p	CLIP-seq
MIRT2142947	hsa-miR-544b	CLIP-seq
MIRT2142948	hsa-miR-661	CLIP-seq
MIRT2142949	hsa-miR-767-3p	CLIP-seq
MIRT2363304	hsa-miR-1207-5p	CLIP-seq
MIRT2363305	hsa-miR-1292	CLIP-seq
MIRT2363306	hsa-miR-1293	CLIP-seq
MIRT2142932	hsa-miR-1298	CLIP-seq
MIRT2363307	hsa-miR-1321	CLIP-seq
MIRT2363308	hsa-miR-143	CLIP-seq
MIRT2363309	hsa-miR-185	CLIP-seq
MIRT2363310	hsa-miR-2467-3p	CLIP-seq
MIRT2142934	hsa-miR-3065-3p	CLIP-seq
MIRT2363311	hsa-miR-3126-5p	CLIP-seq
MIRT2363312	hsa-miR-3144-5p	CLIP-seq
MIRT2363313	hsa-miR-3151	CLIP-seq
MIRT2363314	hsa-miR-3191	CLIP-seq
MIRT2363315	hsa-miR-3192	CLIP-seq
MIRT2363316	hsa-miR-3201	CLIP-seq
MIRT2363317	hsa-miR-326	CLIP-seq
MIRT2363318	hsa-miR-330-5p	CLIP-seq
MIRT2363319	hsa-miR-338-3p	CLIP-seq
MIRT2363320	hsa-miR-342-5p	CLIP-seq
MIRT2142936	hsa-miR-3675-5p	CLIP-seq
MIRT2363321	hsa-miR-3678-3p	CLIP-seq
MIRT2363322	hsa-miR-3689d	CLIP-seq
MIRT2142937	hsa-miR-371-3p	CLIP-seq
MIRT2142938	hsa-miR-371b-3p	CLIP-seq
MIRT2363323	hsa-miR-4281	CLIP-seq
MIRT2363324	hsa-miR-4283	CLIP-seq
MIRT2363325	hsa-miR-4306	CLIP-seq
MIRT2363326	hsa-miR-4314	CLIP-seq
MIRT2363327	hsa-miR-4419a	CLIP-seq
MIRT2363328	hsa-miR-4446-3p	CLIP-seq
MIRT2363329	hsa-miR-4447	CLIP-seq
MIRT2363330	hsa-miR-4456	CLIP-seq
MIRT2363331	hsa-miR-4457	CLIP-seq
MIRT2363332	hsa-miR-4463	CLIP-seq
MIRT2363333	hsa-miR-4472	CLIP-seq
MIRT2142941	hsa-miR-4473	CLIP-seq
MIRT2363334	hsa-miR-4474-3p	CLIP-seq
MIRT2363335	hsa-miR-4483	CLIP-seq
MIRT2363336	hsa-miR-4489	CLIP-seq
MIRT2363337	hsa-miR-4505	CLIP-seq
MIRT2363338	hsa-miR-4510	CLIP-seq
MIRT2363339	hsa-miR-4522	CLIP-seq
MIRT2363340	hsa-miR-4530	CLIP-seq
MIRT2363341	hsa-miR-4640-5p	CLIP-seq
MIRT2363342	hsa-miR-4644	CLIP-seq
MIRT2363343	hsa-miR-4646-5p	CLIP-seq
MIRT2363344	hsa-miR-4651	CLIP-seq
MIRT2363345	hsa-miR-4652-5p	CLIP-seq
MIRT2363346	hsa-miR-4656	CLIP-seq
MIRT2363347	hsa-miR-4664-5p	CLIP-seq
MIRT2363348	hsa-miR-4667-5p	CLIP-seq
MIRT2142942	hsa-miR-4671-3p	CLIP-seq
MIRT2363349	hsa-miR-4685-5p	CLIP-seq
MIRT2363350	hsa-miR-4700-5p	CLIP-seq
MIRT2363351	hsa-miR-4726-5p	CLIP-seq
MIRT2363352	hsa-miR-4731-5p	CLIP-seq
MIRT2363353	hsa-miR-4739	CLIP-seq
MIRT2363354	hsa-miR-4756-5p	CLIP-seq
MIRT2363355	hsa-miR-4763-3p	CLIP-seq
MIRT2363356	hsa-miR-4770	CLIP-seq
MIRT2363357	hsa-miR-4791	CLIP-seq
MIRT2363358	hsa-miR-485-5p	CLIP-seq
MIRT2363359	hsa-miR-490-3p	CLIP-seq
MIRT2363360	hsa-miR-491-5p	CLIP-seq
MIRT2363361	hsa-miR-508-5p	CLIP-seq
MIRT2142945	hsa-miR-515-3p	CLIP-seq
MIRT2142946	hsa-miR-519e	CLIP-seq
MIRT2363362	hsa-miR-541	CLIP-seq
MIRT2142947	hsa-miR-544b	CLIP-seq
MIRT2363363	hsa-miR-596	CLIP-seq
MIRT2363364	hsa-miR-608	CLIP-seq
MIRT2363365	hsa-miR-648	CLIP-seq
MIRT2363366	hsa-miR-649	CLIP-seq
MIRT2363367	hsa-miR-654-5p	CLIP-seq
MIRT2363368	hsa-miR-766	CLIP-seq
MIRT2657140	hsa-miR-1915	CLIP-seq
MIRT2363313	hsa-miR-3151	CLIP-seq
MIRT2657141	hsa-miR-3155	CLIP-seq
MIRT2657142	hsa-miR-3155b	CLIP-seq
MIRT2363319	hsa-miR-338-3p	CLIP-seq
MIRT2657143	hsa-miR-339-5p	CLIP-seq
MIRT1474893	hsa-miR-371-5p	CLIP-seq
MIRT2657144	hsa-miR-3922-5p	CLIP-seq
MIRT2657145	hsa-miR-4287	CLIP-seq
MIRT2363329	hsa-miR-4447	CLIP-seq
MIRT2363331	hsa-miR-4457	CLIP-seq
MIRT2657146	hsa-miR-4469	CLIP-seq
MIRT2363333	hsa-miR-4472	CLIP-seq
MIRT2363334	hsa-miR-4474-3p	CLIP-seq
MIRT2363340	hsa-miR-4530	CLIP-seq
MIRT2657147	hsa-miR-4685-3p	CLIP-seq
MIRT2657148	hsa-miR-4726-3p	CLIP-seq
MIRT2657149	hsa-miR-4747-3p	CLIP-seq
MIRT2657150	hsa-miR-484	CLIP-seq
MIRT2363360	hsa-miR-491-5p	CLIP-seq
MIRT2363361	hsa-miR-508-5p	CLIP-seq
MIRT2657151	hsa-miR-515-5p	CLIP-seq
MIRT2657152	hsa-miR-642a	CLIP-seq
MIRT2363365	hsa-miR-648	CLIP-seq
MIRT2363368	hsa-miR-766	CLIP-seq

35 Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000407	Component	Phagophore assembly site	IBA
GO:0000407	Component	Phagophore assembly site	TAS	19279323
GO:0000423	Process	Mitophagy	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19878745, 20643644, 31279575
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	20643644, 25036637, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19878745
GO:0005737	Component	Cytoplasm	IEA
GO:0005776	Component	Autophagosome	IBA
GO:0005829	Component	Cytosol	IBA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	TAS	19279323
GO:0007224	Process	Smoothened signaling pathway	IDA	31279575
GO:0010506	Process	Regulation of autophagy	IBA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0034045	Component	Phagophore assembly site membrane	IBA
GO:0034727	Process	Piecemeal microautophagy of the nucleus	IBA
GO:0042594	Process	Response to starvation	IBA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IDA	20643644
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IDA	19878745, 20643644
GO:0046777	Process	Protein autophosphorylation	IDA	19878745, 20643644
GO:0061709	Process	Reticulophagy	IBA
GO:0072537	Process	Fibroblast activation	IMP	28877478
GO:0090398	Process	Cellular senescence	TAS	19279323
GO:0097542	Component	Ciliary tip	TAS
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
613472	19703	ENSG00000140474

Q6PHR2

Protein name

Serine/threonine-protein kinase ULK3 (EC 2.7.11.1) (Unc-51-like kinase 3)

Protein function

Serine/threonine protein kinase that acts as a regulator of Sonic hedgehog (SHH) signaling and autophagy. Acts as a negative regulator of SHH signaling in the absence of SHH ligand: interacts with SUFU, thereby inactivating the protein kinase ac

PDB

4WZX , 6FDY , 6FDZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04212	MIT	281 → 346	MIT (microtubule interacting and transport) domain	Domain
PF04212	MIT	376 → 442	MIT (microtubule interacting and transport) domain	Domain
PF00069	Pkinase	14 → 270	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest levels observed in fetal brain. In adult tissues, high levels in brain, liver and kidney, moderate levels in testis and adrenal gland and low levels in heart, lung, stomach, thymus, prostate and placenta. In t

Sequence

MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLL
TEIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQ
LASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYM
APEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPLLS
RDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGESLGRATALVVQAVKKDQEGDS
AAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSSSNQALLRQGT
SARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPG
RRRELLHTEVQNLMARAEYLKEQVKMRESRWEADTLDKEGLSESVRSSCTLQ

Sequence length

472

Interactions

View interactions

Reactome Pathway
Hedgehog 'on' state

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CELIAC DISEASE	—	GWAS catalog	25920553	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	36187959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (15)
Breast Neoplasms	Breast neoplasm	Pubtator	31629678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39351539	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36797248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26898941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34315829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	32555714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24335696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24335696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36797248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20479155, 26751575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28877478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28877478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32977850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	36797248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33289601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ULK3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ULK3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ULK3 (see Related Genes above), that are NOT already directly curated for ULK3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ULK3.

ULK3 (unc-51 like kinase 3)

Bookmark This Gene