UFSP1 (UFM1 specific peptidase 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 402682
• Gene name: UFM1 specific peptidase 1
• Gene symbol: UFSP1
• Synonyms (NCBI Gene): UFSP
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human U

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1472986	hsa-miR-3689a-3p	CLIP-seq
MIRT1472987	hsa-miR-3689c	CLIP-seq
MIRT1472988	hsa-miR-376c	CLIP-seq
MIRT1472989	hsa-miR-4728-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	35926457
GO:0005829	Component	Cytosol	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IDA	35525273, 35926457
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0051604	Process	Protein maturation	IDA	35525273, 35926457
GO:0071567	Function	DeUFMylase activity	IBA
GO:0071567	Function	DeUFMylase activity	IDA	35525273, 35926457
GO:0071567	Function	DeUFMylase activity	IEA
GO:0071569	Process	Protein ufmylation	IDA	15071506, 20018847, 27653677, 30886146, 32160526
GO:0071569	Process	Protein ufmylation	IDA	35525273, 35926457
GO:0071569	Process	Protein ufmylation	IMP	27545681, 29868776, 32160526

Other IDs

• MIM: 611481
• HGNC: 33821
• e!Ensembl: ENSG00000176125

Protein

• UniProt ID: Q6NVU6
• Protein name: Ufm1-specific protease 1 (UfSP1) (EC 3.4.22.-)
• Protein function: Thiol-dependent isopeptidase that specifically mediate the processing of UFM1 precursors as well as the deconjugation of UFM1 from target proteins (PubMed:35525273, PubMed:35926457). Mainly responsible for the maturation of the UFM1 precursor, a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07910	Peptidase_C78	3 → 128	Peptidase family C78	Family

• Sequence:

  MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGP
  VMVGGDADARSKALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQAAGWVGWQEVSAAFD
  PNSFYNLCLTSLSSQQQQRTLD

• Sequence length: 142

Related Genes

No strongly related genes found yet for UFSP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to UFSP1.