Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	642623
Gene name	Upstream binding transcription factor like 1
Gene symbol	UBTFL1
Synonyms (NCBI Gene)	C11orf27HMGPI
Chromosome	11
Chromosome location	11q14.3
Summary	UBTFL1 is a preimplantation-specific gene and is involved in early development, implantation, and embryonic stem (ES) cell derivation (summary by Yamada et al., 2010 [PubMed 19915186]).[supplied by OMIM, Jan 2011]

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001164	Function	RNA polymerase I core promoter sequence-specific DNA binding	IBA
GO:0001181	Function	RNA polymerase I general transcription initiation factor activity	IBA
GO:0001188	Process	RNA polymerase I preinitiation complex assembly	IEA
GO:0001832	Process	Blastocyst growth	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006360	Process	Transcription by RNA polymerase I	IBA
GO:0007566	Process	Embryo implantation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	IBA

MIM	HGNC	e!Ensembl
613696	14533	ENSG00000255009

P0CB47

Protein name

Upstream-binding factor 1-like protein 1

Protein function

Essential for proliferation of the inner cell mass and trophectodermal cells in peri-implantation development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00505	HMG_box	100 → 168	HMG (high mobility group) box	Domain

Sequence

MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKW
LEISCNLRKFGTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQ
MYPGMRSQELTKILSKKYRELPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKK
SSVSKRTQNKVQKKFQKNIEEVRSLPKTDRFFKKVKFHGEPQKPPMNGYHKFHQDSWSSK
EMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQYKVKLDLWLKTLSPENYAAYK
ESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDSSQTIWVNCHV
SMEPEENRKKDREKEESSNSSDCSSGEEIEVDV

Sequence length

393

Interactions

View interactions

Related Genes Genes most often co-reported with UBTFL1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for UBTFL1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to UBTFL1 (see Related Genes above), that are NOT already directly curated for UBTFL1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to UBTFL1.

UBTFL1 (upstream binding transcription factor like 1)

Bookmark This Gene