UBL7 (ubiquitin like 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84993
• Gene name: Ubiquitin like 7
• Gene symbol: UBL7
• Synonyms (NCBI Gene): BMSC-UbP, TCBA1
• Chromosome: 15
• Chromosome location: 15q24.1

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044174	hsa-miR-99b-5p	CLASH	23622248
MIRT041777	hsa-miR-484	CLASH	23622248
MIRT1470107	hsa-miR-150	CLIP-seq
MIRT1470108	hsa-miR-2276	CLIP-seq
MIRT1470109	hsa-miR-3127-5p	CLIP-seq
MIRT1470110	hsa-miR-4270	CLIP-seq
MIRT1470111	hsa-miR-4271	CLIP-seq
MIRT1470112	hsa-miR-4436b-3p	CLIP-seq
MIRT1470113	hsa-miR-4441	CLIP-seq
MIRT1470114	hsa-miR-4725-3p	CLIP-seq
MIRT1470115	hsa-miR-4731-5p	CLIP-seq
MIRT1470116	hsa-miR-4772-3p	CLIP-seq
MIRT1470117	hsa-miR-637	CLIP-seq
MIRT1470118	hsa-miR-891b	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 25910212, 26871637, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	36943869
GO:0005829	Component	Cytosol	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	36943869
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IBA
GO:0044314	Process	Protein K27-linked ubiquitination	IDA	26342464
GO:0045087	Process	Innate immune response	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	27992402, 36943869
GO:0140374	Process	Antiviral innate immune response	IDA	36943869

Other IDs

• MIM: 609748
• HGNC: 28221
• e!Ensembl: ENSG00000138629

Protein

• UniProt ID: Q96S82
• Protein name: Ubiquitin-like protein 7 (Bone marrow stromal cell ubiquitin-like protein) (BMSC-UbP) (Ubiquitin-like protein SB132)
• Protein function: Interferon-stimulated protein that positively regulates RNA virus-triggered innate immune signaling. Mechanistically, promotes 'Lys-27'-linked polyubiquitination of MAVS through TRIM21 leading to enhanced the IFN signaling pathway. {ECO:0000269|
• PDB: 2CWB , 2DEN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	37 → 93	Ubiquitin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highly expressed in heart, skeletal muscle, testis, thyroid and adrenal gland. {ECO:0000269|PubMed:12644319}.
• Sequence:

  MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPEL
  IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTAL
  HSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVP
  AHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNT
  RSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGT
  SPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRAL
  QATGGDIQAALELIFAGGAP

• Sequence length: 380

Related Genes

No strongly related genes found yet for UBL7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to UBL7.