UBALD1 (UBA like domain containing 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 124402
Gene name UBA like domain containing 1
Gene symbol UBALD1
Synonyms (NCBI Gene)
FAM100APP11303
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
49 Show/Hide all (49)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT050440 hsa-miR-23a-3p CLASH 23622248
MIRT464901 hsa-miR-6165 PAR-CLIP 23592263
MIRT464900 hsa-miR-4690-5p PAR-CLIP 23592263
MIRT464899 hsa-miR-6510-5p PAR-CLIP 23592263
MIRT464898 hsa-miR-9500 PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TB05
Protein name UBA-like domain-containing protein 1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14555 UBA_4 11 → 53 Domain
Sequence 
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQ
MMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSA
ASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Sequence length 177
Interactions View interactions

No strongly related genes found yet for UBALD1.

No additional diseases found yet through genes similar to UBALD1.