TXLNGY (taxilin gamma Y-linked (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 246126
Gene name Taxilin gamma Y-linked (pseudogene)
Gene symbol TXLNGY
Synonyms (NCBI Gene)
CYorf15ACYorf15BTXLNG2P
Chromosome Y
Chromosome location Yq11.222-q11.223
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0019905 Function Syntaxin binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
400031 18473 ENSG00000291033
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BZA5
Protein name Putative gamma-taxilin 2 (Gamma-taxilin 2 pseudogene) (Taxilin gamma pseudogene, Y-linked)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12815422, ECO:0000269|Ref.1}.
Sequence 
MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPV
HCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLGKEVLLLMQALNTLSTPEEKLAALCK
KYADLGNSPLL
Sequence length 131
Interactions View interactions

No strongly related genes found yet for TXLNGY.

No additional diseases found yet through genes similar to TXLNGY.