TVP23B (trans-golgi network vesicle protein 23 homolog B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51030
Gene name Trans-golgi network vesicle protein 23 homolog B
Gene symbol TVP23B
Synonyms (NCBI Gene)
CGI-148FAM18BFAM18B1NPD008YDR084C
Chromosome 17
Chromosome location 17p11.2
miRNA miRNA information provided by mirtarbase database.
27 Show/Hide all (27)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT050260 hsa-miR-25-3p CLASH 23622248
MIRT553280 hsa-miR-5582-3p PAR-CLIP 21572407
MIRT286011 hsa-miR-651-3p PAR-CLIP 21572407
MIRT286013 hsa-miR-4323 PAR-CLIP 21572407
MIRT553279 hsa-miR-3943 PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0009306 Process Protein secretion IBA
GO:0016020 Component Membrane IEA
GO:0016192 Process Vesicle-mediated transport IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYZ1
Protein name Golgi apparatus membrane protein TVP23 homolog B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05832 DUF846 32 → 174 Eukaryotic protein of unknown function (DUF846) Family
Sequence 
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSS
FITCMVTIILLLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVS
EAESRIFWLGLIACPVLWVIFAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVRSRK
HLTSMATSYFGKQFLRQNTGDDQTS
Sequence length 205
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Colon adenocarcinoma Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (7)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Diabetes Mellitus Diabetes Mellitus BEFREE 25221423
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetic Retinopathy Diabetic Retinopathy BEFREE 25221423
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetic Retinopathy Diabetic retinopathy Pubtator 25221423 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Hyperglycemia Hyperglycemia BEFREE 25221423
★★★★★
★☆☆☆☆
Found in Text Mining only
Hyperglycemia Hyperglycemia Pubtator 25221423 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only
Proliferative diabetic retinopathy Proliferative Diabetic Retinopathy BEFREE 25221423
★★★★★
★☆☆☆☆
Found in Text Mining only
Retinal Diseases Retinal Diseases BEFREE 25221423
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for TVP23B.

No additional diseases found yet through genes similar to TVP23B.