Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10382
Gene name	Tubulin beta 4A class IVa
Gene symbol	TUBB4A
Synonyms (NCBI Gene)	DYT4TUBB4beta-5
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a member of the beta tubulin family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene cause hypomyelinating leukodystrophy-6 and au

33 Show/Hide all (33)

SNP ID	Visualize variation	Clinical significance	Consequence
rs369467354	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs483352809	C>T	Pathogenic	Coding sequence variant, missense variant
rs587776983	G>A,C,T	Pathogenic	5 prime UTR variant, coding sequence variant, synonymous variant, missense variant
rs587777074	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs587777428	C>T	Pathogenic	Coding sequence variant, missense variant
rs587777429	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs587777467	C>G,T	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs587777468	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs748787734	G>A,C	Likely-pathogenic	Synonymous variant, coding sequence variant, missense variant
rs756762431	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs761635539	G>A	Pathogenic	Missense variant, coding sequence variant
rs767399782	C>A,T	Pathogenic-likely-pathogenic, pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs797045074	C>G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs886039470	C>T	Pathogenic	Missense variant, coding sequence variant
rs886041007	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs886041008	G>T	Pathogenic	Missense variant, coding sequence variant
rs886041009	C>A	Pathogenic	Missense variant, coding sequence variant
rs886041010	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs886041011	G>T	Pathogenic	Missense variant, coding sequence variant
rs886041012	C>A	Pathogenic	Missense variant, coding sequence variant
rs886041013	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs886041014	A>C	Pathogenic	Missense variant, coding sequence variant
rs886041015	C>A,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs886041016	C>T	Pathogenic	Missense variant, coding sequence variant
rs886041017	G>T	Pathogenic	Missense variant, coding sequence variant
rs886041018	A>G,T	Pathogenic	Missense variant, coding sequence variant
rs886041019	T>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs886041020	A>G	Pathogenic	Missense variant, coding sequence variant
rs886041021	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs886041022	A>C,G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1057517986	C>G	Pathogenic	Coding sequence variant, missense variant
rs1131691696	C>T	Pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs1599405952	G>T	Likely-pathogenic	Coding sequence variant, missense variant

32 Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022751	hsa-miR-124-3p	Microarray	18668037
MIRT036536	hsa-miR-1226-3p	CLASH	23622248
MIRT513393	hsa-miR-3974	PAR-CLIP	23446348
MIRT513392	hsa-miR-488-5p	PAR-CLIP	23446348
MIRT513390	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT513391	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT513389	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT513388	hsa-miR-6845-3p	PAR-CLIP	23446348
MIRT513387	hsa-miR-1909-3p	PAR-CLIP	23446348
MIRT513386	hsa-miR-6722-3p	PAR-CLIP	23446348
MIRT513385	hsa-miR-1207-5p	PAR-CLIP	23446348
MIRT513384	hsa-miR-4763-3p	PAR-CLIP	23446348
MIRT513383	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT513381	hsa-miR-6873-3p	PAR-CLIP	23446348
MIRT513382	hsa-miR-4768-5p	PAR-CLIP	23446348
MIRT513380	hsa-miR-6833-3p	PAR-CLIP	23446348
MIRT513379	hsa-miR-6809-3p	PAR-CLIP	23446348
MIRT513393	hsa-miR-3974	PAR-CLIP	23446348
MIRT513392	hsa-miR-488-5p	PAR-CLIP	23446348
MIRT513390	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT513391	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT513389	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT513388	hsa-miR-6845-3p	PAR-CLIP	23446348
MIRT513387	hsa-miR-1909-3p	PAR-CLIP	23446348
MIRT513386	hsa-miR-6722-3p	PAR-CLIP	23446348
MIRT513385	hsa-miR-1207-5p	PAR-CLIP	23446348
MIRT513384	hsa-miR-4763-3p	PAR-CLIP	23446348
MIRT513383	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT513381	hsa-miR-6873-3p	PAR-CLIP	23446348
MIRT513382	hsa-miR-4768-5p	PAR-CLIP	23446348
MIRT513380	hsa-miR-6833-3p	PAR-CLIP	23446348
MIRT513379	hsa-miR-6809-3p	PAR-CLIP	23446348

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IEA
GO:0005509	Function	Calcium ion binding	IMP	10211825
GO:0005515	Function	Protein binding	IPI	20195357, 24275654, 31046837
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IDA	12475942
GO:0007017	Process	Microtubule-based process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0031115	Process	Negative regulation of microtubule polymerization	IMP	10211825
GO:0033269	Component	Internode region of axon	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043209	Component	Myelin sheath	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045171	Component	Intercellular bridge	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072686	Component	Mitotic spindle	IDA
GO:0072686	Component	Mitotic spindle	IEA

MIM	HGNC	e!Ensembl
602662	20774	ENSG00000104833

P04350

Protein name

Tubulin beta-4A chain (Tubulin 5 beta) (Tubulin beta-4 chain)

Protein function

Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule en

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00091	Tubulin	3 → 212	Tubulin/FtsZ family, GTPase domain	Domain
PF03953	Tubulin_C	261 → 383	Tubulin C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Major isotype in brain, where it represents 46% of all beta-tubulins. In the brain, highest expression levels in the cerebellum, followed by putamen and white matter. Moderate levels in testis. Very low levels, if any, in other tissues

Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA

Sequence length

444

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Phagosome	Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane
Gap junction	MHC class II antigen presentation
Motor proteins	Separation of Sister Chromatids
Alzheimer disease	Resolution of Sister Chromatid Cohesion
Parkinson disease	Regulation of PLK1 Activity at G2/M Transition
Amyotrophic lateral sclerosis	HSP90 chaperone cycle for steroid hormone receptors (SHR)
Huntington disease	Loss of Nlp from mitotic centrosomes
Prion disease	Recruitment of mitotic centrosome proteins and complexes
Pathways of neurodegeneration - multiple diseases	Loss of proteins required for interphase microtubule organization from the centrosome
Pathogenic Escherichia coli infection	Recruitment of NuMA to mitotic centrosomes
Salmonella infection	Recycling pathway of L1
	Hedgehog 'off' state
	Cilium Assembly
	Anchoring of the basal body to the plasma membrane
	Intraflagellar transport
	RHO GTPases activate IQGAPs
	RHO GTPases Activate Formins
	COPI-mediated anterograde transport
	COPI-dependent Golgi-to-ER retrograde traffic
	COPI-independent Golgi-to-ER retrograde traffic
	Mitotic Prometaphase
	The role of GTSE1 in G2/M progression after G2 checkpoint
	AURKA Activation by TPX2
	Carboxyterminal post-translational modifications of tubulin
	HCMV Early Events
	Aggrephagy
	EML4 and NUDC in mitotic spindle formation
	Sealing of the nuclear envelope (NE) by ESCRT-III
	Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar Show/Hide Causal Diseases (10)
Abnormality of the nervous system	Likely pathogenic; Pathogenic	rs483352809	RCV001814029	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Auditory neuropathy spectrum disorder	Likely pathogenic; Pathogenic	rs886039470	RCV003984834	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral palsy	Likely pathogenic; Pathogenic	rs587777428, rs767399782	RCV001795219 RCV001004001	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Likely pathogenic; Pathogenic	rs587777428	RCV002463648	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypomyelinating leukodystrophy 6	Likely pathogenic; Pathogenic	rs2145244590, rs587777428, rs587777429, rs2145244734, rs587777467, rs587777468, rs886041008, rs2512754593, rs761635539, rs797045074, rs767399782, rs2512753619, rs1914525410, rs886039470, rs886041021 View all (16 more)	RCV001663402 RCV000122736 RCV000122737 RCV002014654 RCV000128409 View all (30 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Leukodystrophy	Likely pathogenic; Pathogenic	rs886041007	RCV005625493	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Likely pathogenic; Pathogenic	rs767399782	RCV001527369	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Torsion dystonia 4	Likely pathogenic; Pathogenic	rs552079378, rs587777428, rs886041008, rs767399782, rs886041021, rs587777468, rs1131691696, rs587776983, rs483352809, rs886041022	RCV001335377 RCV000763442 RCV002262174 RCV004798804 RCV001249222 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TUBB4A-related disorder	Likely pathogenic; Pathogenic	rs587777429	RCV003982897	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TUBB4A-related neurologic disorder	Likely pathogenic; Pathogenic	rs886041021	RCV006249623	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (17)
ATROPHY/DEGENERATION AFFECTING THE CEREBELLUM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brown syndrome	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BROWN TENDON SHEATH SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Classic medulloblastoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL NEUROLOGIC ANOMALIES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTONIA 4, TORSION, AUTOSOMAL DOMINANT	—	HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTONIA MUSCULORUM DEFORMANS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTONIA MUSCULORUM DEFORMANS 4	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonic disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL TORSION DYSTONIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC TORSION DYSTONIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC FAMILIAL DYSTONIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKODYSTROPHY, HYPOMYELINATING, 6	—	Disgenet, HPO Disgenet, HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY DYSTONIA, DYT4 TYPE	—	Orphanet	27809427	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBB4A-related hypomyelinating leukodystrophy and/or torsion dystonia	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WHISPERING DYSPHONIA, HEREDITARY	—	CTD, Disgenet CTD, Disgenet	12692554, 15026312, 15536153, 17087743, 19264920, 19321197, 20592249, 21890643, 22438253, 22596258, 23009155, 23734232, 24139496, 27059040, 9570576	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (89)
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	23582646, 28655586, 28973395, 35275727, 37003180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	34514881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	24785942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharospasm	Blepharospasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28973395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	25085639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	25085639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chorea	Chorea	Pubtator	24598712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis	Choreoathetosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	BEFREE	28130172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Complicated hereditary spastic paraplegia	Spastic paraplegia	BEFREE	25772097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	24860126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	24742798, 24785942, 25085639, 28973395, 29451896, 34514881, 40179460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34514881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	CLINVAR_DG	24785942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	CLINVAR_DG	24785942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysphonia	Dysphonia	Pubtator	23595291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	23582646, 23595291, 24598712, 28655586, 32943487, 35275727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DYSTONIA 4, TORSION, AUTOSOMAL DOMINANT (disorder)	Dystonia	UNIPROT_DG	23424103		★★★★★ ★☆☆☆☆ Found in Text Mining only
DYSTONIA 4, TORSION, AUTOSOMAL DOMINANT (disorder)	Dystonia	GENOMICS_ENGLAND_DG	23582646, 24526230, 25497598, 25655951		★★★★★ ★☆☆☆☆ Found in Text Mining only
DYSTONIA 4, TORSION, AUTOSOMAL DOMINANT (disorder)	Dystonia	BEFREE	28655586, 28973395		★★★★★ ★☆☆☆☆ Found in Text Mining only
DYSTONIA 4, TORSION, AUTOSOMAL DOMINANT (disorder)	Dystonia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
DYSTONIA 4, TORSION, AUTOSOMAL DOMINANT (disorder)	Dystonia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	21956287, 23424103, 23582646, 23595291, 24262166, 24598712, 24785942, 24952478, 25643588, 25772097, 26318963, 28655586, 29127012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Musculorum Deformans	Dystonia	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonia musculorum deformans 4	Dystonia musculorum deformans	Pubtator	24785942	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonia, Primary	Dystonia	BEFREE	23775978, 24598712, 28973395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	24598712, 24742798, 28655586, 28973395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early onset torsion dystonia	Dystonia	BEFREE	12194383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	28973395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Dystonia	Dystonia	BEFREE	24742798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31491891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31491891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG	24785942		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	30079973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypomyelination with atrophy of basal ganglia and cerebellum	Hypomyelination With Atrophy Of Basal Ganglia And Cerebellum	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30738969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	24598712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	28973395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal dystonia	Laryngeal dystonia	BEFREE	23595291, 27093447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal dystonia	Laryngeal dystonia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	32943487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	24742798, 28393430, 28655586, 30079973		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukodystrophy	Leukodystrophy	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukodystrophy Hypomyelinating 6	Hypomyelinating leukodystrophy	Pubtator	23582646, 24598712, 24742798, 24785942, 25085639, 28655586, 28973395, 35275727, 37003180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	32573057, 37003180, 37461315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Hypomyelinating, 6	Leukodystrophy	CLINVAR_DG	23424103, 23582646, 24706558, 24742798, 24785942, 24850488, 24974158, 25085639, 25168210, 25356970, 25497598, 25545912, 25772097, 26633545, 26643067, 28973395, 29451896 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 6	Leukodystrophy	UNIPROT_DG	23582646		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 6	Leukodystrophy	GENOMICS_ENGLAND_DG	24357685, 24526230, 25497598, 25655951, 26643067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukoencephalopathy	Leukoencephalopathy	BEFREE	23582646, 24598712, 24850488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	BEFREE	24179174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36173063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	24598712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	28130172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	23246003, 28130172, 30738969		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Movement Disorders	Movement Disorders	CLINVAR_DG	12372733, 20191564, 21956287, 23424103, 23582646, 23595291, 24526230, 24706558, 24742798, 24785942, 24850488, 24974158, 25085639, 25168210, 25545912 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	37461315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	37461315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25772097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30079973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24526230, 25545912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	CLINVAR_DG	24785942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher disease	BEFREE	24974158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	BEFREE	24860126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary dystonia, DYT4 type	Dystonia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35589707	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	40179460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	30079973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Quadriplegia	Spastic Quadriplegia	BEFREE	28973395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37161060	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetraplegia/tetraparesis	Tetraparesis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Whispering dysphonia hereditary	Whispering dysphonia	Pubtator	23595291, 24598712, 28655586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Whispering dysphonia, hereditary	Whispering dysphonia	GENOMICS_ENGLAND_DG	23582646, 24526230, 25497598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Whispering dysphonia, hereditary	Whispering dysphonia	BEFREE	25545912, 26643067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Whispering dysphonia, hereditary	Whispering dysphonia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Whispering dysphonia, hereditary	Whispering dysphonia	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TUBA1A	2	["Cerebral palsy","Congenital neurologic anomalies"]	36	["Phagosome","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport","COPI-dependent Golgi-to-ER retrograde traffic","Separation of Sister Chromatids"]	2	["Disgenet (Cerebral palsy)","Disgenet (Congenital neurologic anomalies)"]
THAP1	4	["Dystonia","Dystonia musculorum deformans","Torsion dystonia","Genetic torsion dystonia"]	0	[]	7	["Disgenet (Dystonia)","HPO (Dystonia)","Orphanet (Dystonia)","Disgenet (Dystonia musculorum deformans)","Disgenet (Genetic torsion dystonia)","ClinVar (Torsion dystonia)","GenCC (Torsion dystonia)"]
TUBB4B	0	[]	36	["Phagosome","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport","COPI-dependent Golgi-to-ER retrograde traffic","Separation of Sister Chromatids"]	0	[]
HPCA	4	["Dystonia","Dystonia musculorum deformans","Torsion dystonia","Genetic torsion dystonia"]	0	[]	7	["Disgenet (Dystonia)","HPO (Dystonia)","Orphanet (Dystonia)","Disgenet (Dystonia musculorum deformans)","Disgenet (Genetic torsion dystonia)","ClinVar (Torsion dystonia)","GenCC (Torsion dystonia)"]
TUBA4A	0	[]	36	["Phagosome","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport","COPI-dependent Golgi-to-ER retrograde traffic","Separation of Sister Chromatids"]	0	[]

TUBB4A (tubulin beta 4A class IVa)

Bookmark This Gene