TTTY13 (testis expressed transcript, Y-linked 13)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 83868 |
| Gene name | Testis expressed transcript, Y-linked 13 |
| Gene symbol | TTTY13 |
| Synonyms (NCBI Gene) |
NCRNA00136TTY13
|
| Chromosome | Y |
| Chromosome location | Yq11.223 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9BZ97 |
| Protein name | Putative transcript Y 13 protein |
| Family and domains | |
| Sequence |
MKTQDDGVLPPYDVNQLLGWDLNLSLFLGLCLMLLLAGSCLPSPGITGLSHGSNREDR |
| Sequence length | 58 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TTTY13 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TTTY13 (see Related Genes above), that are NOT already directly curated for TTTY13 itself -- a lead worth checking, not a confirmed association.
0
|
|