TTTY12 (testis expressed transcript, Y-linked 12)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 83867 |
| Gene name | Testis expressed transcript, Y-linked 12 |
| Gene symbol | TTTY12 |
| Synonyms (NCBI Gene) |
NCRNA00135TTY11TTY12
|
| Chromosome | Y |
| Chromosome location | Yp11.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9BZ98 |
| Protein name | Putative transcript Y 12 protein |
| Family and domains | |
| Sequence |
MIDPETRHKAFLKAWPWQNSTITFVPGLAICHYSSVQVPRRGAILPMLYALCYVKMPSFQ |
| Sequence length | 90 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TTTY12 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TTTY12 (see Related Genes above), that are NOT already directly curated for TTTY12 itself -- a lead worth checking, not a confirmed association.
0
|
|