Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	23548
Gene name	Tetratricopeptide repeat domain 33
Gene symbol	TTC33
Synonyms (NCBI Gene)	OSRF
Chromosome	5
Chromosome location	5p13.1

388 Show/Hide all (388)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024248	hsa-miR-218-5p	Sequencing	20371350
MIRT030950	hsa-miR-21-5p	Microarray	19253296
MIRT030950	hsa-miR-21-5p	Microarray	19342589
MIRT718160	hsa-miR-22-3p	HITS-CLIP	19536157
MIRT718159	hsa-miR-556-5p	HITS-CLIP	19536157
MIRT718158	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT718157	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT718156	hsa-miR-1248	HITS-CLIP	19536157
MIRT718155	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT718154	hsa-miR-3160-3p	HITS-CLIP	19536157
MIRT718153	hsa-miR-558	HITS-CLIP	19536157
MIRT718152	hsa-miR-4487	HITS-CLIP	19536157
MIRT718151	hsa-miR-4297	HITS-CLIP	19536157
MIRT718150	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT718149	hsa-miR-6882-3p	HITS-CLIP	19536157
MIRT718148	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT718147	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT718146	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT560701	hsa-miR-500a-5p	PAR-CLIP	20371350
MIRT560700	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT571139	hsa-miR-300	PAR-CLIP	20371350
MIRT571138	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT560699	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT560698	hsa-miR-532-5p	PAR-CLIP	20371350
MIRT560697	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT560696	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT560695	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT571137	hsa-miR-1284	PAR-CLIP	20371350
MIRT560694	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT560693	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT571136	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT571135	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT571134	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT571133	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT560692	hsa-miR-4633-5p	PAR-CLIP	20371350
MIRT560691	hsa-miR-6083	PAR-CLIP	20371350
MIRT560701	hsa-miR-500a-5p	PAR-CLIP	20371350
MIRT560700	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT560699	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT560698	hsa-miR-532-5p	PAR-CLIP	20371350
MIRT560697	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT560696	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT560695	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT560694	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT560693	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT560692	hsa-miR-4633-5p	PAR-CLIP	20371350
MIRT560691	hsa-miR-6083	PAR-CLIP	20371350
MIRT718160	hsa-miR-22-3p	HITS-CLIP	19536157
MIRT718159	hsa-miR-556-5p	HITS-CLIP	19536157
MIRT718158	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT718157	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT718156	hsa-miR-1248	HITS-CLIP	19536157
MIRT718155	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT718154	hsa-miR-3160-3p	HITS-CLIP	19536157
MIRT718153	hsa-miR-558	HITS-CLIP	19536157
MIRT718152	hsa-miR-4487	HITS-CLIP	19536157
MIRT718151	hsa-miR-4297	HITS-CLIP	19536157
MIRT718150	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT718149	hsa-miR-6882-3p	HITS-CLIP	19536157
MIRT718148	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT718147	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT718146	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT560701	hsa-miR-500a-5p	PAR-CLIP	20371350
MIRT560700	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT571139	hsa-miR-300	PAR-CLIP	20371350
MIRT571138	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT560699	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT560698	hsa-miR-532-5p	PAR-CLIP	20371350
MIRT560697	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT560696	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT560695	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT571137	hsa-miR-1284	PAR-CLIP	20371350
MIRT560694	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT560693	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT571136	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT571135	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT571134	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT571133	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT560692	hsa-miR-4633-5p	PAR-CLIP	20371350
MIRT560691	hsa-miR-6083	PAR-CLIP	20371350
MIRT560701	hsa-miR-500a-5p	PAR-CLIP	20371350
MIRT560700	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT560699	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT560698	hsa-miR-532-5p	PAR-CLIP	20371350
MIRT560697	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT560696	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT560695	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT560694	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT560693	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT560692	hsa-miR-4633-5p	PAR-CLIP	20371350
MIRT560691	hsa-miR-6083	PAR-CLIP	20371350
MIRT1461409	hsa-miR-101	CLIP-seq
MIRT1461410	hsa-miR-1200	CLIP-seq
MIRT1461411	hsa-miR-1255a	CLIP-seq
MIRT1461412	hsa-miR-1255b	CLIP-seq
MIRT1461413	hsa-miR-1265	CLIP-seq
MIRT1461414	hsa-miR-1296	CLIP-seq
MIRT1461415	hsa-miR-1323	CLIP-seq
MIRT1461416	hsa-miR-144	CLIP-seq
MIRT1461417	hsa-miR-154	CLIP-seq
MIRT1461418	hsa-miR-15a	CLIP-seq
MIRT1461419	hsa-miR-15b	CLIP-seq
MIRT1461420	hsa-miR-16	CLIP-seq
MIRT1461421	hsa-miR-1910	CLIP-seq
MIRT1461422	hsa-miR-195	CLIP-seq
MIRT1461423	hsa-miR-216a	CLIP-seq
MIRT1461424	hsa-miR-2909	CLIP-seq
MIRT1461425	hsa-miR-3065-5p	CLIP-seq
MIRT1461426	hsa-miR-3120-3p	CLIP-seq
MIRT1461427	hsa-miR-3125	CLIP-seq
MIRT1461428	hsa-miR-3126-3p	CLIP-seq
MIRT1461429	hsa-miR-3150a-5p	CLIP-seq
MIRT1461430	hsa-miR-3150b-5p	CLIP-seq
MIRT1461431	hsa-miR-3183	CLIP-seq
MIRT1461432	hsa-miR-3605-5p	CLIP-seq
MIRT1461433	hsa-miR-3616-5p	CLIP-seq
MIRT1461434	hsa-miR-3647-5p	CLIP-seq
MIRT1461435	hsa-miR-3659	CLIP-seq
MIRT1461436	hsa-miR-381	CLIP-seq
MIRT1461437	hsa-miR-3916	CLIP-seq
MIRT1461438	hsa-miR-3973	CLIP-seq
MIRT1461439	hsa-miR-424	CLIP-seq
MIRT1461440	hsa-miR-425	CLIP-seq
MIRT1461441	hsa-miR-4264	CLIP-seq
MIRT1461442	hsa-miR-4289	CLIP-seq
MIRT1461443	hsa-miR-4311	CLIP-seq
MIRT1461444	hsa-miR-4324	CLIP-seq
MIRT1461445	hsa-miR-4455	CLIP-seq
MIRT1461446	hsa-miR-4512	CLIP-seq
MIRT1461447	hsa-miR-451b	CLIP-seq
MIRT1461448	hsa-miR-4524	CLIP-seq
MIRT1461449	hsa-miR-455-3p	CLIP-seq
MIRT1461450	hsa-miR-4637	CLIP-seq
MIRT1461451	hsa-miR-4658	CLIP-seq
MIRT1461452	hsa-miR-4666-3p	CLIP-seq
MIRT1461453	hsa-miR-4723-3p	CLIP-seq
MIRT1461454	hsa-miR-4738-3p	CLIP-seq
MIRT1461455	hsa-miR-4766-5p	CLIP-seq
MIRT1461456	hsa-miR-4786-3p	CLIP-seq
MIRT1461457	hsa-miR-4795-5p	CLIP-seq
MIRT1461458	hsa-miR-4797-3p	CLIP-seq
MIRT1461459	hsa-miR-4802-3p	CLIP-seq
MIRT1461460	hsa-miR-490-5p	CLIP-seq
MIRT1461461	hsa-miR-497	CLIP-seq
MIRT1461462	hsa-miR-500a	CLIP-seq
MIRT1461463	hsa-miR-503	CLIP-seq
MIRT1461464	hsa-miR-505	CLIP-seq
MIRT1461465	hsa-miR-518d-5p	CLIP-seq
MIRT1461466	hsa-miR-519b-5p	CLIP-seq
MIRT1461467	hsa-miR-519c-5p	CLIP-seq
MIRT1461468	hsa-miR-520c-5p	CLIP-seq
MIRT1461469	hsa-miR-520g	CLIP-seq
MIRT1461470	hsa-miR-520h	CLIP-seq
MIRT1461471	hsa-miR-526a	CLIP-seq
MIRT1461472	hsa-miR-544b	CLIP-seq
MIRT1461473	hsa-miR-545	CLIP-seq
MIRT1461474	hsa-miR-548aa	CLIP-seq
MIRT1461475	hsa-miR-548ac	CLIP-seq
MIRT1461476	hsa-miR-548ae	CLIP-seq
MIRT1461477	hsa-miR-548aj	CLIP-seq
MIRT1461478	hsa-miR-548am	CLIP-seq
MIRT1461479	hsa-miR-548d-3p	CLIP-seq
MIRT1461480	hsa-miR-548o	CLIP-seq
MIRT1461481	hsa-miR-548x	CLIP-seq
MIRT1461482	hsa-miR-548z	CLIP-seq
MIRT1461483	hsa-miR-555	CLIP-seq
MIRT1461484	hsa-miR-573	CLIP-seq
MIRT1461485	hsa-miR-574-5p	CLIP-seq
MIRT1461486	hsa-miR-582-5p	CLIP-seq
MIRT1461487	hsa-miR-609	CLIP-seq
MIRT1461488	hsa-miR-646	CLIP-seq
MIRT1461489	hsa-miR-654-3p	CLIP-seq
MIRT1461490	hsa-miR-664	CLIP-seq
MIRT1461491	hsa-miR-671-5p	CLIP-seq
MIRT1461492	hsa-miR-877	CLIP-seq
MIRT1461425	hsa-miR-3065-5p	CLIP-seq
MIRT1461464	hsa-miR-505	CLIP-seq
MIRT1461465	hsa-miR-518d-5p	CLIP-seq
MIRT1461466	hsa-miR-519b-5p	CLIP-seq
MIRT1461467	hsa-miR-519c-5p	CLIP-seq
MIRT1461468	hsa-miR-520c-5p	CLIP-seq
MIRT1461471	hsa-miR-526a	CLIP-seq
MIRT1555242	hsa-miR-607	CLIP-seq
MIRT2138660	hsa-miR-103b	CLIP-seq
MIRT1461410	hsa-miR-1200	CLIP-seq
MIRT2138661	hsa-miR-1305	CLIP-seq
MIRT2138662	hsa-miR-23a	CLIP-seq
MIRT2138663	hsa-miR-23b	CLIP-seq
MIRT2138664	hsa-miR-23c	CLIP-seq
MIRT2138665	hsa-miR-2681	CLIP-seq
MIRT1461425	hsa-miR-3065-5p	CLIP-seq
MIRT2138666	hsa-miR-3074-3p	CLIP-seq
MIRT2138667	hsa-miR-3614-3p	CLIP-seq
MIRT2138668	hsa-miR-3651	CLIP-seq
MIRT2138669	hsa-miR-3675-3p	CLIP-seq
MIRT2138670	hsa-miR-3692	CLIP-seq
MIRT2138671	hsa-miR-410	CLIP-seq
MIRT1461444	hsa-miR-4324	CLIP-seq
MIRT1461451	hsa-miR-4658	CLIP-seq
MIRT1461452	hsa-miR-4666-3p	CLIP-seq
MIRT2138672	hsa-miR-4701-5p	CLIP-seq
MIRT2138673	hsa-miR-4719	CLIP-seq
MIRT2138674	hsa-miR-4775	CLIP-seq
MIRT2138675	hsa-miR-485-3p	CLIP-seq
MIRT1461464	hsa-miR-505	CLIP-seq
MIRT1461465	hsa-miR-518d-5p	CLIP-seq
MIRT1461466	hsa-miR-519b-5p	CLIP-seq
MIRT1461467	hsa-miR-519c-5p	CLIP-seq
MIRT1461468	hsa-miR-520c-5p	CLIP-seq
MIRT1461471	hsa-miR-526a	CLIP-seq
MIRT1461472	hsa-miR-544b	CLIP-seq
MIRT2138676	hsa-miR-586	CLIP-seq
MIRT2138677	hsa-miR-588	CLIP-seq
MIRT2138678	hsa-miR-603	CLIP-seq
MIRT1555242	hsa-miR-607	CLIP-seq
MIRT2138679	hsa-miR-656	CLIP-seq
MIRT1461410	hsa-miR-1200	CLIP-seq
MIRT2359508	hsa-miR-1243	CLIP-seq
MIRT2359509	hsa-miR-1244	CLIP-seq
MIRT2359510	hsa-miR-200b	CLIP-seq
MIRT2359511	hsa-miR-200c	CLIP-seq
MIRT2138662	hsa-miR-23a	CLIP-seq
MIRT2138663	hsa-miR-23b	CLIP-seq
MIRT2138664	hsa-miR-23c	CLIP-seq
MIRT2138666	hsa-miR-3074-3p	CLIP-seq
MIRT2359512	hsa-miR-3168	CLIP-seq
MIRT2359513	hsa-miR-3613-3p	CLIP-seq
MIRT2138667	hsa-miR-3614-3p	CLIP-seq
MIRT2359514	hsa-miR-362-5p	CLIP-seq
MIRT2138668	hsa-miR-3651	CLIP-seq
MIRT2359515	hsa-miR-3654	CLIP-seq
MIRT2359516	hsa-miR-3671	CLIP-seq
MIRT2359517	hsa-miR-3919	CLIP-seq
MIRT2359518	hsa-miR-4277	CLIP-seq
MIRT2359519	hsa-miR-429	CLIP-seq
MIRT1461444	hsa-miR-4324	CLIP-seq
MIRT2359520	hsa-miR-4506	CLIP-seq
MIRT2359521	hsa-miR-4714-3p	CLIP-seq
MIRT2359522	hsa-miR-4756-3p	CLIP-seq
MIRT2138675	hsa-miR-485-3p	CLIP-seq
MIRT2359523	hsa-miR-494	CLIP-seq
MIRT1461462	hsa-miR-500a	CLIP-seq
MIRT2359524	hsa-miR-500b	CLIP-seq
MIRT1461472	hsa-miR-544b	CLIP-seq
MIRT2359525	hsa-miR-550b	CLIP-seq
MIRT1555242	hsa-miR-607	CLIP-seq
MIRT2359526	hsa-miR-621	CLIP-seq
MIRT2138679	hsa-miR-656	CLIP-seq
MIRT2359527	hsa-miR-944	CLIP-seq
MIRT2396456	hsa-miR-3130-3p	CLIP-seq
MIRT2359518	hsa-miR-4277	CLIP-seq
MIRT2396457	hsa-miR-4793-3p	CLIP-seq
MIRT2396458	hsa-miR-544	CLIP-seq
MIRT2396459	hsa-miR-579	CLIP-seq
MIRT1555242	hsa-miR-607	CLIP-seq
MIRT1461490	hsa-miR-664	CLIP-seq
MIRT2652763	hsa-miR-1193	CLIP-seq
MIRT2138661	hsa-miR-1305	CLIP-seq
MIRT1461415	hsa-miR-1323	CLIP-seq
MIRT2652764	hsa-miR-140-5p	CLIP-seq
MIRT2652765	hsa-miR-150	CLIP-seq
MIRT2652766	hsa-miR-186	CLIP-seq
MIRT2652767	hsa-miR-2053	CLIP-seq
MIRT2652768	hsa-miR-2392	CLIP-seq
MIRT2652769	hsa-miR-297	CLIP-seq
MIRT2652770	hsa-miR-302a	CLIP-seq
MIRT2652771	hsa-miR-302b	CLIP-seq
MIRT2652772	hsa-miR-302c	CLIP-seq
MIRT2652773	hsa-miR-302d	CLIP-seq
MIRT2652774	hsa-miR-302e	CLIP-seq
MIRT2138666	hsa-miR-3074-3p	CLIP-seq
MIRT1461426	hsa-miR-3120-3p	CLIP-seq
MIRT2652775	hsa-miR-3148	CLIP-seq
MIRT2652776	hsa-miR-3149	CLIP-seq
MIRT1461429	hsa-miR-3150a-5p	CLIP-seq
MIRT1461430	hsa-miR-3150b-5p	CLIP-seq
MIRT2652777	hsa-miR-3163	CLIP-seq
MIRT1461431	hsa-miR-3183	CLIP-seq
MIRT2652778	hsa-miR-323-5p	CLIP-seq
MIRT2652779	hsa-miR-323b-3p	CLIP-seq
MIRT2652780	hsa-miR-3545-5p	CLIP-seq
MIRT1461433	hsa-miR-3616-5p	CLIP-seq
MIRT1461434	hsa-miR-3647-5p	CLIP-seq
MIRT2138668	hsa-miR-3651	CLIP-seq
MIRT2652781	hsa-miR-3658	CLIP-seq
MIRT2652782	hsa-miR-3668	CLIP-seq
MIRT2652783	hsa-miR-3682-3p	CLIP-seq
MIRT2652784	hsa-miR-372	CLIP-seq
MIRT2652785	hsa-miR-373	CLIP-seq
MIRT2652786	hsa-miR-3922-5p	CLIP-seq
MIRT2652787	hsa-miR-3975	CLIP-seq
MIRT2138671	hsa-miR-410	CLIP-seq
MIRT2652788	hsa-miR-4282	CLIP-seq
MIRT1461443	hsa-miR-4311	CLIP-seq
MIRT1461445	hsa-miR-4455	CLIP-seq
MIRT2652789	hsa-miR-4460	CLIP-seq
MIRT2652790	hsa-miR-4477a	CLIP-seq
MIRT2652791	hsa-miR-4477b	CLIP-seq
MIRT2652792	hsa-miR-4502	CLIP-seq
MIRT1461447	hsa-miR-451b	CLIP-seq
MIRT2652793	hsa-miR-4662a-3p	CLIP-seq
MIRT2652794	hsa-miR-4668-5p	CLIP-seq
MIRT2652795	hsa-miR-4713-5p	CLIP-seq
MIRT1461453	hsa-miR-4723-3p	CLIP-seq
MIRT2652796	hsa-miR-4735-5p	CLIP-seq
MIRT1461454	hsa-miR-4738-3p	CLIP-seq
MIRT2652797	hsa-miR-4747-3p	CLIP-seq
MIRT2652798	hsa-miR-4762-3p	CLIP-seq
MIRT2138674	hsa-miR-4775	CLIP-seq
MIRT1461457	hsa-miR-4795-5p	CLIP-seq
MIRT2652799	hsa-miR-498	CLIP-seq
MIRT2652800	hsa-miR-518e	CLIP-seq
MIRT2652801	hsa-miR-520a-3p	CLIP-seq
MIRT2652802	hsa-miR-520b	CLIP-seq
MIRT2652803	hsa-miR-520c-3p	CLIP-seq
MIRT2652804	hsa-miR-520d-3p	CLIP-seq
MIRT2652805	hsa-miR-520e	CLIP-seq
MIRT2652806	hsa-miR-532-3p	CLIP-seq
MIRT1461473	hsa-miR-545	CLIP-seq
MIRT1461480	hsa-miR-548o	CLIP-seq
MIRT2652807	hsa-miR-567	CLIP-seq
MIRT2652808	hsa-miR-569	CLIP-seq
MIRT1461484	hsa-miR-573	CLIP-seq
MIRT2652809	hsa-miR-577	CLIP-seq
MIRT2652810	hsa-miR-583	CLIP-seq
MIRT2138676	hsa-miR-586	CLIP-seq
MIRT2652811	hsa-miR-590-3p	CLIP-seq
MIRT2138678	hsa-miR-603	CLIP-seq
MIRT1461487	hsa-miR-609	CLIP-seq
MIRT2652812	hsa-miR-610	CLIP-seq
MIRT2359526	hsa-miR-621	CLIP-seq
MIRT2652813	hsa-miR-876-3p	CLIP-seq
MIRT2652814	hsa-miR-889	CLIP-seq
MIRT2652763	hsa-miR-1193	CLIP-seq
MIRT2138661	hsa-miR-1305	CLIP-seq
MIRT1461415	hsa-miR-1323	CLIP-seq
MIRT2652764	hsa-miR-140-5p	CLIP-seq
MIRT2652765	hsa-miR-150	CLIP-seq
MIRT2652766	hsa-miR-186	CLIP-seq
MIRT2652768	hsa-miR-2392	CLIP-seq
MIRT2652770	hsa-miR-302a	CLIP-seq
MIRT2652771	hsa-miR-302b	CLIP-seq
MIRT2652772	hsa-miR-302c	CLIP-seq
MIRT2652773	hsa-miR-302d	CLIP-seq
MIRT2652774	hsa-miR-302e	CLIP-seq
MIRT2138666	hsa-miR-3074-3p	CLIP-seq
MIRT1461426	hsa-miR-3120-3p	CLIP-seq
MIRT1461429	hsa-miR-3150a-5p	CLIP-seq
MIRT1461430	hsa-miR-3150b-5p	CLIP-seq
MIRT1461431	hsa-miR-3183	CLIP-seq
MIRT2652778	hsa-miR-323-5p	CLIP-seq
MIRT2652780	hsa-miR-3545-5p	CLIP-seq
MIRT1461433	hsa-miR-3616-5p	CLIP-seq
MIRT1461434	hsa-miR-3647-5p	CLIP-seq
MIRT2652783	hsa-miR-3682-3p	CLIP-seq
MIRT2652784	hsa-miR-372	CLIP-seq
MIRT2652785	hsa-miR-373	CLIP-seq
MIRT2652786	hsa-miR-3922-5p	CLIP-seq
MIRT2138671	hsa-miR-410	CLIP-seq
MIRT1461445	hsa-miR-4455	CLIP-seq
MIRT2652789	hsa-miR-4460	CLIP-seq
MIRT2652790	hsa-miR-4477a	CLIP-seq
MIRT2652791	hsa-miR-4477b	CLIP-seq
MIRT2652792	hsa-miR-4502	CLIP-seq
MIRT1461447	hsa-miR-451b	CLIP-seq
MIRT2652795	hsa-miR-4713-5p	CLIP-seq
MIRT1461453	hsa-miR-4723-3p	CLIP-seq
MIRT2652796	hsa-miR-4735-5p	CLIP-seq
MIRT1461454	hsa-miR-4738-3p	CLIP-seq
MIRT2652798	hsa-miR-4762-3p	CLIP-seq
MIRT2138674	hsa-miR-4775	CLIP-seq
MIRT1461457	hsa-miR-4795-5p	CLIP-seq
MIRT2652799	hsa-miR-498	CLIP-seq
MIRT2652800	hsa-miR-518e	CLIP-seq
MIRT2652801	hsa-miR-520a-3p	CLIP-seq
MIRT2652802	hsa-miR-520b	CLIP-seq
MIRT2652803	hsa-miR-520c-3p	CLIP-seq
MIRT2652804	hsa-miR-520d-3p	CLIP-seq
MIRT2652805	hsa-miR-520e	CLIP-seq
MIRT2652806	hsa-miR-532-3p	CLIP-seq
MIRT1461473	hsa-miR-545	CLIP-seq
MIRT1461480	hsa-miR-548o	CLIP-seq
MIRT1461484	hsa-miR-573	CLIP-seq
MIRT2652811	hsa-miR-590-3p	CLIP-seq
MIRT2138678	hsa-miR-603	CLIP-seq
MIRT1461487	hsa-miR-609	CLIP-seq
MIRT2652812	hsa-miR-610	CLIP-seq
MIRT2652813	hsa-miR-876-3p	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 32814053

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6PID6

Protein name

Tetratricopeptide repeat protein 33 (TPR repeat protein 33) (Osmosis-responsive factor)

Family and domains

Sequence

MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSK
QLKDEGASLAENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAV
QQNPHSWESWQTLGRAQLGLGEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKV
AQRIKKSEAPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKEKTVSANKTMVIVSASGAI
ETVTEKEDGATPPDGSVFIKAR

Sequence length

262

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (56)
ALZHEIMER DISEASE	—	GWAS catalog	38184787	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	21743469, 23749187, 26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	29083406, 31361310	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	20889312	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	30510241	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	29917119, 30510241, 31089142, 34594039, 36539618, 37340002, 38872215	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	17447842, 17554261, 17554300, 17684544, 18587394, 21102463, 22412388, 22936669, 23128233, 26192919, 26278503, 26301688, 26974007, 28067908, 33600772, 33608531, 33686288, 37156999, 37523193, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	26098866, 31383772, 32514122, 33002439, 34594039, 37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	26098866, 31383772, 32514122, 33002439, 34594039, 37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33356394	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	33830181	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	37337107	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	17447842, 17554261, 17554300, 17684544, 18587394, 21102463, 22412388, 22936669, 23128233, 26192919, 26278503, 28067908, 33600772, 33608531, 37156999, 37523193, 37965154, 39792054	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	20889312	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	19525953, 21833088, 22570697, 24076602, 28445677, 31604244, 40262193	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	25939698, 26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	33686288, 36333501	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	20889312	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	27723758	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	26301688, 34127860, 39749473	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	34127860, 39749473	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	21297633, 23128233, 26192919, 26301688, 26974007, 28067908, 33600772, 33608531, 33686288, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Lymphoma	Lymphoma	Pubtator	33883344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	22037555		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	GWASCAT_DG	31383772		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
STMN3	15	["Autoimmune disease","Autoimmune thyroid disease","Biliary tract cancer","Cancer","Celiac disease","Cervical cancer","Common variable immunodeficiency","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer"]	[]	17	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)"]
MYO9B	12	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Gastric ulcer","Non-hodgkins lymphoma","Ovarian serous carcinoma","Respiratory system disease"]	[]	13	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Gastric ulcer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
LY6K	12	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Gastric ulcer","Non-hodgkins lymphoma","Ovarian serous carcinoma","Peptic ulcer disease"]	[]	13	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Gastric ulcer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
POU2AF3	11	["Biliary tract cancer","Cancer","Celiac disease","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma"]	[]	12	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
TESPA1	11	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma","Respiratory system disease"]	[]	12	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)","GWAS catalog (Respiratory system disease)"]

TTC33 (tetratricopeptide repeat domain 33)

Save This Analysis