TTC32 (tetratricopeptide repeat domain 32)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 130502
Gene name Tetratricopeptide repeat domain 32
Gene symbol TTC32
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p24.1
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT049501 hsa-miR-92a-3p CLASH 23622248
MIRT1461330 hsa-miR-4699-3p CLIP-seq
MIRT1461331 hsa-miR-4795-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5I0X7
Protein name Tetratricopeptide repeat protein 32 (TPR repeat protein 32)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00515 TPR_1 93 → 125 Tetratricopeptide repeat Repeat
PF13432 TPR_16 3 → 46 Family
Sequence 
MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATA
YNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLD
LNPGFQDATLSLKQTILDKEEKQRRNVAKNY
Sequence length 151
Interactions View interactions

No strongly related genes found yet for TTC32.

No additional diseases found yet through genes similar to TTC32.