TTC23L (tetratricopeptide repeat domain 23 like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 153657
Gene name Tetratricopeptide repeat domain 23 like
Gene symbol TTC23L
Synonyms (NCBI Gene)
MC25-1
Chromosome 5
Chromosome location 5p13.2
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017471 hsa-miR-335-5p Microarray 18185580
MIRT2442775 hsa-miR-1305 CLIP-seq
MIRT2442776 hsa-miR-3976 CLIP-seq
MIRT2442777 hsa-miR-486-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22458338, 24722188, 25416956, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IEA
GO:0005819 Component Spindle IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616344 26355 ENSG00000205838
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PF05
Protein name Tetratricopeptide repeat protein 23-like
Family and domains
Sequence 
MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEETKAKEKEKAI
DCMSHPKEKLAQSQKKVAQLIKEKMNTQANKELIRCVILSRIIFGDHHWKCARALANLAY
GYLTLRGLPVQAKKHATSAKNTLLTWKANTTSNKEKEEILEALVKLYYTLGVAWLLQNRG
REAYFNLQKAERNMKELKELYKGGVCELQVSENDLTLALGRASLAIHRLNLALAYFEKAI
GDVIAAKGDRTSDLISLYEEAAQIEQLRRNHNQAIQYLQQAHSVCVSLFTEVSPKTAEMS
ALLAKAYAMSGEAQHRDAVEIYFIRSINAYRATLGSEDFETLSTTEEFCKWLVQNGEKQD
K
Sequence length 361
Interactions View interactions

No strongly related genes found yet for TTC23L.

No additional diseases found yet through genes similar to TTC23L.