TSTD3 (thiosulfate sulfurtransferase like domain containing 3)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100130890 |
| Gene name | Thiosulfate sulfurtransferase like domain containing 3 |
| Gene symbol | TSTD3 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 6 |
| Chromosome location | 6q16.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
H0UI37 | ||||||||||
| Protein name | Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (Rhodanese domain-containing protein 3) | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQK |
||||||||||
| Sequence length | 97 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with TSTD3 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TSTD3 (see Related Genes above), that are NOT already directly curated for TSTD3 itself -- a lead worth checking, not a confirmed association.
0
|
|