TSTD1 (thiosulfate sulfurtransferase like domain containing 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100131187
Gene name Thiosulfate sulfurtransferase like domain containing 1
Gene symbol TSTD1
Synonyms (NCBI Gene)
KATTST
Chromosome 1
Chromosome location 1q23.3
miRNA miRNA information provided by mirtarbase database.
20 Show/Hide all (20)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018442 hsa-miR-335-5p Microarray 18185580
MIRT1460660 hsa-miR-1228 CLIP-seq
MIRT1460661 hsa-miR-18a CLIP-seq
MIRT1460662 hsa-miR-18b CLIP-seq
MIRT1460663 hsa-miR-197 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 12817473
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616041 35410 ENSG00000215845
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NFU3
Protein name Thiosulfate:glutathione sulfurtransferase (TST) (EC 2.8.1.3)
Protein function Thiosulfate:glutathione sulfurtransferase (TST) required to produce S-sulfanylglutathione (GSS(-)), a central intermediate in hydrogen sulfide metabolism (PubMed:24981631). Provides the link between the first step in mammalian H(2)S metabolism p
PDB 6BEV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00581 Rhodanese 8 → 113 Rhodanese-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in kidney, liver and skeletal muscle. Lower levels of expression in heart, colon, thymus, spleen, placenta and lung. Weakly expressed in brain, small intestine and peripheral blood leukocytes. Expressed at high levels
Sequence 
MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQ
ALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES
Sequence length 115
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Sulfide oxidation to sulfate
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Colon adenocarcinoma Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (66)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult-Onset Vitelliform Macular Dystrophy Vitelliform Macular Dystrophy BEFREE 12566026, 16885924, 18050133, 9338584
★★★★★
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 10202289, 10704489, 12882809, 14557182, 16885924, 16916875, 19262438, 20213611, 24463884, 8045710, 8058286, 8302543, 8485576, 8602784
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37715200 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 19825993, 9177396
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic valve stenosis Pubtator 36780769 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease Polycystic kidney disease BEFREE 9503014
★★★★★
★☆☆☆☆
Found in Text Mining only
Bronchopulmonary Dysplasia Bronchopulmonary Dysplasia BEFREE 1514107, 31722581
★★★★★
★☆☆☆☆
Found in Text Mining only
Butterfly-shaped pigmentary macular dystrophy Macular dystrophy, patterned BEFREE 8545803
★★★★★
★☆☆☆☆
Found in Text Mining only
Calcinosis Calcinosis Pubtator 36780769 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 9177396
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for TSTD1.

No additional diseases found yet through genes similar to TSTD1.