TSSK6 (testis specific serine kinase 6)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 83983
• Gene name: Testis specific serine kinase 6
• Gene symbol: TSSK6
• Synonyms (NCBI Gene): CT72, FKSG82, SSTK, TSSK4
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: This intronless gene encodes a member of the CAMK (calcium/calmodulin-dependent) serine/threonine protein kinase family. The encoded kinase has a broad expression pattern but is described as testis-specific due to effects on fertility. Male mice which lac

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT446189	hsa-miR-5003-3p	PAR-CLIP	22100165
MIRT446189	hsa-miR-5003-3p	PAR-CLIP	22100165
MIRT446189	hsa-miR-5003-3p	PAR-CLIP	22100165
MIRT446189	hsa-miR-5003-3p	PAR-CLIP	22100165
MIRT1460618	hsa-miR-1205	CLIP-seq
MIRT1460619	hsa-miR-1281	CLIP-seq
MIRT1460620	hsa-miR-1286	CLIP-seq
MIRT1460621	hsa-miR-3652	CLIP-seq
MIRT1460622	hsa-miR-4267	CLIP-seq
MIRT1460623	hsa-miR-4430	CLIP-seq
MIRT1460624	hsa-miR-4505	CLIP-seq
MIRT1460625	hsa-miR-4532	CLIP-seq
MIRT1460626	hsa-miR-4722-5p	CLIP-seq
MIRT1460627	hsa-miR-4787-3p	CLIP-seq
MIRT1460628	hsa-miR-604	CLIP-seq
MIRT1460629	hsa-miR-638	CLIP-seq
MIRT1460630	hsa-miR-647	CLIP-seq
MIRT1460631	hsa-miR-766	CLIP-seq
MIRT1460632	hsa-miR-938	CLIP-seq
MIRT2359209	hsa-miR-103a	CLIP-seq
MIRT2359210	hsa-miR-107	CLIP-seq
MIRT2359211	hsa-miR-15a	CLIP-seq
MIRT2359212	hsa-miR-15b	CLIP-seq
MIRT2359213	hsa-miR-16	CLIP-seq
MIRT2359214	hsa-miR-195	CLIP-seq
MIRT2359215	hsa-miR-3186-3p	CLIP-seq
MIRT2359216	hsa-miR-3944-5p	CLIP-seq
MIRT2359217	hsa-miR-424	CLIP-seq
MIRT2359218	hsa-miR-497	CLIP-seq
MIRT2359219	hsa-miR-518a-3p	CLIP-seq
MIRT2359220	hsa-miR-518b	CLIP-seq
MIRT2359221	hsa-miR-518c	CLIP-seq
MIRT2359222	hsa-miR-518d-3p	CLIP-seq
MIRT2359223	hsa-miR-518f	CLIP-seq

Gene ontology (GO) Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	15870294
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15870294
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15870294, 20829357, 22939624, 25036637, 32707033, 33961781
GO:0005524	Function	ATP binding	IDA	15870294
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0006468	Process	Protein phosphorylation	IDA	15870294
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0035092	Process	Sperm DNA condensation	IEA
GO:0035092	Process	Sperm DNA condensation	ISS
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0160110	Component	Axonemal microtubule doublet inner sheath	IEA
GO:0160110	Component	Axonemal microtubule doublet inner sheath	ISS

Other IDs

• MIM: 610712
• HGNC: 30410
• e!Ensembl: ENSG00000178093

Protein

• UniProt ID: Q9BXA6
• Protein name: Testis-specific serine/threonine-protein kinase 6 (TSK-6) (TSSK-6) (Testis-specific kinase 6) (EC 2.7.11.1) (Cancer/testis antigen 72) (CT72) (Serine/threonine-protein kinase SSTK) (Small serine/threonine kinase)
• Protein function: Serine/threonine-protein kinase component of the sperm flagellar doublet microtubules (PubMed:15870294). May act as a regulator of sperm motility by mediating phosphorylation of sperm doublet microtubule proteins (By similarity). Plays a role in
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	12 → 267	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis. Expressed at lower levels in colon, small intestine, ovary, prostate, thymus, spleen and peripheral blood leukocytes. {ECO:0000269|PubMed:15870294}.
• Sequence:

  MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRE
  LSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIA
  GAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASP
  EVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERC
  KALIAELLQFSPSARPSAGQVARNCWLRAGDSG

• Sequence length: 273

Related Genes

No strongly related genes found yet for TSSK6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TSSK6.