TSSK4 (testis specific serine kinase 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 283629
• Gene name: Testis specific serine kinase 4
• Gene symbol: TSSK4
• Synonyms (NCBI Gene): C14orf20, STK22E, TSK-4, TSK4, TSSK5
• Chromosome: 14
• Chromosome location: 14q12
• Summary: This gene encodes a member of the testis-specific serine/threonine kinase family. The encoded protein is thought to be involved in spermatogenesis via stimulation of the CREB/CRE responsive pathway through phosphorylation of the cAMP responsive element bi

Gene ontology (GO) Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	15964553
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15964553
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	15964553, 21988832, 30683861
GO:0005524	Function	ATP binding	IDA	15964553
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005929	Component	Cilium	IEA
GO:0006468	Process	Protein phosphorylation	IDA	15964553
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0009566	Process	Fertilization	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	IDA	15964553
GO:0036126	Component	Sperm flagellum	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 610711
• HGNC: 19825
• e!Ensembl: ENSG00000139908

Protein

• UniProt ID: Q6SA08
• Protein name: Testis-specific serine/threonine-protein kinase 4 (TSK-4) (TSSK-4) (Testis-specific kinase 4) (EC 2.7.11.1) (Serine/threonine-protein kinase 22E)
• Protein function: Serine/threonine kinase which is involved in male germ cell development and in mature sperm function (By similarity). May be involved in the Cre/Creb signaling pathway (By similarity). Phosphorylates CREB1 on 'Ser-133' in vitro and can stimulate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	25 → 293	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed only in the testis. {ECO:0000269|PubMed:15964553}.
• Sequence:

  MGKGDVLEAAPTTTAYHSLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKK
  ASDDYLNKFLPREIQVMKVLRHKYLINFYRAIESTSRVYIILELAQGGDVLEWIQRYGAC
  SEPLAGKWFSQLTLGIAYLHSKSIVHRDLKLENLLLDKWENVKISDFGFAKMVPSNQPVG
  CSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWSMGVILYTLVVAHLPFD
  DTNLKKLLRETQKEVTFPANHTISQECKNLILQMLRQATKRATILDIIKDSWVLKFQPEQ
  PTHEIRLLEAMCQLHNTTKQHQSLQITT

• Sequence length: 328

Related Genes

No strongly related genes found yet for TSSK4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TSSK4.