TSSK2 (testis specific serine kinase 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23617
• Gene name: Testis specific serine kinase 2
• Gene symbol: TSSK2
• Synonyms (NCBI Gene): DGS-G, SPOGA2, STK22B, TSK2
• Chromosome: 22
• Chromosome location: 22q11.21
• Summary: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1460613	hsa-miR-1914	CLIP-seq
MIRT1460614	hsa-miR-4297	CLIP-seq
MIRT1460615	hsa-miR-4313	CLIP-seq
MIRT1460616	hsa-miR-550a	CLIP-seq
MIRT1460617	hsa-miR-590-3p	CLIP-seq
MIRT2462537	hsa-miR-1248	CLIP-seq
MIRT1460613	hsa-miR-1914	CLIP-seq
MIRT2462538	hsa-miR-3942-3p	CLIP-seq
MIRT1460614	hsa-miR-4297	CLIP-seq
MIRT2462539	hsa-miR-4778-3p	CLIP-seq
MIRT1460616	hsa-miR-550a	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	20729278
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18533145, 20729278
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	15044604, 18533145, 22939624, 32296183, 32707033, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005814	Component	Centriole	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IBA
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	20729278
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 610710
• HGNC: 11401
• e!Ensembl: ENSG00000206203

Protein

• UniProt ID: Q96PF2
• Protein name: Testis-specific serine/threonine-protein kinase 2 (TSK-2) (TSK2) (TSSK-2) (Testis-specific kinase 2) (EC 2.7.11.1) (DiGeorge syndrome protein G) (DGS-G) (Serine/threonine-protein kinase 22B)
• Protein function: Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at 'Ser-288' and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	12 → 272	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis-specific. Present in mature spermatozoa (at protein level). {ECO:0000269|PubMed:15044604, ECO:0000269|PubMed:18533145, ECO:0000269|PubMed:20729278}.
• Sequence:

  MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPRE
  MDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQL
  SSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAA
  YAAPEVLQSIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKN
  LTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD
  TKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST

• Sequence length: 358

Related Genes

No strongly related genes found yet for TSSK2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TSSK2.