TSSC4 (tumor suppressing subtransferable candidate 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 10078
• Gene name: Tumor suppressing subtransferable candidate 4
• Gene symbol: TSSC4
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1460567	hsa-miR-1825	CLIP-seq
MIRT1460568	hsa-miR-2115	CLIP-seq
MIRT1460569	hsa-miR-3162-3p	CLIP-seq
MIRT1460570	hsa-miR-3667-5p	CLIP-seq
MIRT1460571	hsa-miR-4270	CLIP-seq
MIRT1460572	hsa-miR-4441	CLIP-seq
MIRT1460573	hsa-miR-4646-3p	CLIP-seq
MIRT1460574	hsa-miR-4676-5p	CLIP-seq
MIRT1460575	hsa-miR-4690-3p	CLIP-seq
MIRT1460576	hsa-miR-516a-3p	CLIP-seq
MIRT1460577	hsa-miR-520f	CLIP-seq
MIRT1460578	hsa-miR-575	CLIP-seq
MIRT1460579	hsa-miR-665	CLIP-seq
MIRT2138317	hsa-miR-4291	CLIP-seq
MIRT2138318	hsa-miR-545	CLIP-seq
MIRT2138319	hsa-miR-593	CLIP-seq
MIRT2359198	hsa-miR-4267	CLIP-seq
MIRT2359199	hsa-miR-4755-3p	CLIP-seq
MIRT1460576	hsa-miR-516a-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000244	Process	Spliceosomal tri-snRNP complex assembly	IMP	34131137
GO:0000387	Process	Spliceosomal snRNP assembly	IDA	35188580
GO:0005515	Function	Protein binding	IPI	21044950, 21516116, 25416956, 32814053, 34131137
GO:0005634	Component	Nucleus	IDA	34131137
GO:0005634	Component	Nucleus	IEA
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005682	Component	U5 snRNP	IDA	35188580
GO:0005737	Component	Cytoplasm	IDA	34131137
GO:0005737	Component	Cytoplasm	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	34131137
GO:0140313	Function	Molecular sequestering activity	IDA	35188580

Other IDs

• MIM: 603852
• HGNC: 12386
• e!Ensembl: ENSG00000184281

Protein

• UniProt ID: Q9Y5U2
• Protein name: U5 small nuclear ribonucleoprotein TSSC4 (Tumor-suppressing STF cDNA 4 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein)
• Protein function: Protein associated with the U5 snRNP, during its maturation and its post-splicing recycling and which is required for spliceosomal tri-snRNP complex assembly in the nucleus (PubMed:34131137, PubMed:35188580). Has a molecular sequestering activit
• PDB: 7PX3 , 8Q7Q , 8Q7V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15264	TSSC4	94 → 210	Tumour suppressing sub-chromosomal transferable candidate 4	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain, lung, liver and kidney. Widely expressed in adult tissues. {ECO:0000269|PubMed:10072438}.
• Sequence:

  MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDS
  GPDEPPSPPSGLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNG
  GFKRPLAPSGRSPVEGLGRAHRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQA
  TALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGR
  GGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVE
  TVGFHGSRKRSRDHFRNKSSSPEDPGAEV

• Sequence length: 329

Related Genes

No strongly related genes found yet for TSSC4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TSSC4.