Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	115939
Gene name	TSR3 ribosome maturation factor
Gene symbol	TSR3
Synonyms (NCBI Gene)	C16orf42HsTsr3
Chromosome	16
Chromosome location	16p13.3

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000154	Process	RRNA modification	TAS
GO:0000455	Process	Enzyme-directed rRNA pseudouridine synthesis	IEA
GO:0000455	Process	Enzyme-directed rRNA pseudouridine synthesis	IMP	27084949
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006364	Process	RRNA processing	IEA
GO:0016740	Function	Transferase activity	EXP	27084949
GO:0016740	Function	Transferase activity	IEA
GO:0030490	Process	Maturation of SSU-rRNA	IBA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0106388	Function	RRNA small subunit aminocarboxypropyltransferase activity	IEA
GO:0106388	Function	RRNA small subunit aminocarboxypropyltransferase activity	IMP	27084949
GO:1904047	Function	S-adenosyl-L-methionine binding	IEA

MIM	HGNC	e!Ensembl
617058	14175	ENSG00000007520

Q9UJK0

Protein name

18S rRNA aminocarboxypropyltransferase (EC 2.5.1.157) (20S S rRNA accumulation protein 3 homolog) (HsTsr3)

Protein function

Aminocarboxypropyltransferase that catalyzes the aminocarboxypropyl transfer on pseudouridine at position 1248 (Psi1248) in 18S rRNA (Probable). It constitutes the last step in biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypro

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04034	Ribo_biogen_C	96 → 222	Ribosome biogenesis protein, C-terminal	Domain
PF04068	RLI	58 → 92	Possible Fer4-like domain in RNase L inhibitor, RLI	Family

Sequence

MGRRRAARGPGAEGGRPRHLPTRSLEAFAEEVGAALQASVEPGAADGEGGPGPAALPCTL
AMWELGHCDPRRCTGRKLARLGLVRCLRLGHRFGGLVLSPVGKQYASPADRQLVAQSGVA
VIDCSWARLDETPFGKMRGSHLRLLPYLVAANPVNYGRPYRLSCVEAFAATFCIVGFPDL
AVILLRKFKWGKGFLDLNRQLLDKYAACGSPEEVLQAEQEFLANAKESPQEEEIDPFDVD
SGREFGNPNRPVASTRLPSDTDDSDASEDPGPGAERGGASSSCCEEEQTQGRGAEARAPA
EVWKGIKKRQRD

Sequence length

312

Interactions

View interactions

Reactome Pathway
rRNA modification in the nucleus and cytosol

Related Genes Genes most often co-reported with TSR3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TSR3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TSR3 (see Related Genes above), that are NOT already directly curated for TSR3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TSR3.

TSR3 (TSR3 ribosome maturation factor)

Bookmark This Gene