TSPY26P (testis specific protein Y-linked 26, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 128854
Gene name Testis specific protein Y-linked 26, pseudogene
Gene symbol TSPY26P
Synonyms (NCBI Gene)
TSPYL3bA392M18.1
Chromosome 20
Chromosome location 20q11.21
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0003682 Function Chromatin binding IBA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006334 Process Nucleosome assembly IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 16256 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H489
Protein name Putative testis-specific Y-encoded-like protein 3 (TSPY-like protein 3) (Testis-specific Y-encoded protein 26 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00956 NAP 189 → 328 Nucleosome assembly protein (NAP) Family
Sequence 
MADKRAGTPEAAARPPPGLAREGDARTVPAARAREAGGRGSLHPAAGPGTAFPSPGRGEA
ASTATTPSLENGRVRDEAPETCGAEGLGTRAGASEKAEDANKEEGAIFKKEPAEEVEKQQ
EGEEKQEVAAEAQEGPRLLNLGALIVDPLEAIQWEAEAVSAQADRAYLPLERRFGRMHRL
YLARRSFIIQNIPGFWVTAFLNHPQLSAMISPRDEDMLCYLMNLEVRELRHSRTGCKFKF
RFWSNPYFQNKVIVKEYECRASGRVVSIATRIRWHWGQEPPALVHRNRDTVRSFFSWFSQ
HSLPEADRVAQIIKDDLWPNPLQYYLLGDRPCRARGGLARWPTETPSRPYGFQSG
Sequence length 355
Interactions View interactions

No strongly related genes found yet for TSPY26P.

No additional diseases found yet through genes similar to TSPY26P.