TSPO2 (translocator protein 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 222642
• Gene name: Translocator protein 2
• Gene symbol: TSPO2
• Synonyms (NCBI Gene): BZRPL1
• Chromosome: 6
• Chromosome location: 6p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1460064	hsa-miR-3144-5p	CLIP-seq
MIRT1460065	hsa-miR-3148	CLIP-seq
MIRT1460066	hsa-miR-4521	CLIP-seq
MIRT1460067	hsa-miR-4733-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	27641616, 31989647
GO:0005886	Component	Plasma membrane	IEA
GO:0015485	Function	Cholesterol binding	IEA
GO:0015485	Function	Cholesterol binding	ISS
GO:0016020	Component	Membrane	IEA
GO:0031090	Component	Organelle membrane	IDA	27641616
GO:0032367	Process	Intracellular cholesterol transport	IEA
GO:0032367	Process	Intracellular cholesterol transport	ISS
GO:0034389	Process	Lipid droplet organization	IEA
GO:0034389	Process	Lipid droplet organization	ISS
GO:0043353	Process	Enucleate erythrocyte differentiation	IEA
GO:0043353	Process	Enucleate erythrocyte differentiation	ISS
GO:0098739	Process	Import across plasma membrane	IDA	27641616
GO:0140484	Process	5-aminolevulinic acid import across plasma membrane	IMP	31989647
GO:0140485	Function	5-aminolevulinic acid transmembrane transporter activity	IMP	31989647

Other IDs

• MIM: 619409
• HGNC: 21256
• e!Ensembl: ENSG00000112212

Protein

• UniProt ID: Q5TGU0
• Protein name: Translocator protein 2 (Peripheral-type benzodiazepine receptor-like protein 1)
• Protein function: Cholesterol-binding protein involved in the redistribution of cholesterol from lipid droplets to the endoplasmic reticulum (PubMed:19729679). Required to meet cholesterol demands during erythropoietic differentiation (PubMed:19729679). May play
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03073	TspO_MBR	7 → 154	TspO/MBR family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level). {ECO:0000269|PubMed:27641616}.
• Sequence:

  MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYA
  SYLVWKDLGGGLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVST
  ALIWHPINKLAALLLLPYLAWLTVTSALTYHLWRDSLCPVHQPQPTEKSD

• Sequence length: 170

Related Genes

No strongly related genes found yet for TSPO2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TSPO2.