TSACC (TSSK6 activating cochaperone)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 128229
Gene name TSSK6 activating cochaperone
Gene symbol TSACC
Synonyms (NCBI Gene)
C1orf182SIPSSTK-IP
Chromosome 1
Chromosome location 1q22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0051087 Function Protein-folding chaperone binding IBA
GO:0051087 Function Protein-folding chaperone binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619679 30636 ENSG00000163467
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96A04
Protein name TSSK6-activating co-chaperone protein (SSTK-interacting protein) (SIP) (SSTK-IP)
Protein function Co-chaperone that facilitates HSP-mediated activation of TSSK6.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15836 SSTK-IP 1 → 125 SSTK-interacting protein, TSSK6-activating co-chaperone protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis but is absent from mature sperm. {ECO:0000269|PubMed:20829357}.
Sequence 
MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPK
ECLGLLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHL
PQFSK
Sequence length 125
Interactions View interactions

No strongly related genes found yet for TSACC.

No additional diseases found yet through genes similar to TSACC.