Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54952
Gene name	TRNA selenocysteine 1 associated protein 1
Gene symbol	TRNAU1AP
Synonyms (NCBI Gene)	PRO1902SECP43TRSPAP1
Chromosome	1
Chromosome location	1p35.3

37 Show/Hide all (37)

miRTarBase ID	miRNA	Experiments
MIRT1457018	hsa-miR-103a	CLIP-seq
MIRT1457019	hsa-miR-105	CLIP-seq
MIRT1457020	hsa-miR-107	CLIP-seq
MIRT1457021	hsa-miR-1207-5p	CLIP-seq
MIRT1457022	hsa-miR-1270	CLIP-seq
MIRT1457023	hsa-miR-1272	CLIP-seq
MIRT1457024	hsa-miR-1276	CLIP-seq
MIRT1457025	hsa-miR-129-3p	CLIP-seq
MIRT1457026	hsa-miR-1322	CLIP-seq
MIRT1457027	hsa-miR-150	CLIP-seq
MIRT1457028	hsa-miR-183	CLIP-seq
MIRT1457029	hsa-miR-3117-3p	CLIP-seq
MIRT1457030	hsa-miR-3169	CLIP-seq
MIRT1457031	hsa-miR-3171	CLIP-seq
MIRT1457032	hsa-miR-3609	CLIP-seq
MIRT1457033	hsa-miR-3613-5p	CLIP-seq
MIRT1457034	hsa-miR-3646	CLIP-seq
MIRT1457035	hsa-miR-3671	CLIP-seq
MIRT1457036	hsa-miR-3674	CLIP-seq
MIRT1457037	hsa-miR-4311	CLIP-seq
MIRT1457038	hsa-miR-4519	CLIP-seq
MIRT1457039	hsa-miR-4531	CLIP-seq
MIRT1457040	hsa-miR-4683	CLIP-seq
MIRT1457041	hsa-miR-4713-5p	CLIP-seq
MIRT1457042	hsa-miR-4736	CLIP-seq
MIRT1457043	hsa-miR-4759	CLIP-seq
MIRT1457044	hsa-miR-4763-3p	CLIP-seq
MIRT1457045	hsa-miR-520g	CLIP-seq
MIRT1457046	hsa-miR-520h	CLIP-seq
MIRT1457047	hsa-miR-532-3p	CLIP-seq
MIRT1457048	hsa-miR-548ah	CLIP-seq
MIRT1457049	hsa-miR-583	CLIP-seq
MIRT1457050	hsa-miR-620	CLIP-seq
MIRT1457051	hsa-miR-888	CLIP-seq
MIRT1457052	hsa-miR-9	CLIP-seq
MIRT1457053	hsa-miR-938	CLIP-seq
MIRT2357768	hsa-miR-513b	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IBA
GO:0001514	Process	Selenocysteine incorporation	IBA
GO:0001514	Process	Selenocysteine incorporation	IEA
GO:0001514	Process	Selenocysteine incorporation	ISS
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0006412	Process	Translation	IEA

MIM	HGNC	e!Ensembl
619597	30813	ENSG00000180098

Q9NX07

Protein name

tRNA selenocysteine 1-associated protein 1 (SECp43) (tRNA selenocysteine-associated protein 1)

Protein function

Involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. May

PDB

2DHG , 2DIV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	98 → 169	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	5 → 75	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF17654	Trnau1ap	185 → 284	Selenocysteine tRNA 1 associated proteins	Family

Sequence

MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEK
CLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY
PSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRV
KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDA
LEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

Sequence length

287

Interactions

View interactions

Related Genes Genes most often co-reported with TRNAU1AP across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TRNAU1AP.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TRNAU1AP (see Related Genes above), that are NOT already directly curated for TRNAU1AP itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TRNAU1AP.

TRNAU1AP (tRNA selenocysteine 1 associated protein 1)

Bookmark This Gene