TRIM50 (tripartite motif containing 50)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 135892
Gene name Tripartite motif containing 50
Gene symbol TRIM50
Synonyms (NCBI Gene)
TRIM50A
Chromosome 7
Chromosome location 7q11.23
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018041 hsa-miR-335-5p Microarray 18185580
MIRT1455082 hsa-miR-362-5p CLIP-seq
MIRT1455083 hsa-miR-4795-3p CLIP-seq
MIRT1455084 hsa-miR-500b CLIP-seq
MIRT1455085 hsa-miR-501-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 36217029
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612548 19017 ENSG00000146755
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86XT4
Protein name E3 ubiquitin-protein ligase TRIM50 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM50) (Tripartite motif-containing protein 50)
Protein function E3 ubiquitin-protein ligase that ubiquitinates Beclin-1/BECN1 in a 'Lys-63'-dependent manner enhancing its binding to ULK1 (PubMed:29604308). In turn, promotes starvation-induced autophagy activation. Also interacts with p62/SQSTM1 protein and t
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00622 SPRY 348 → 461 SPRY domain Family
PF00643 zf-B_box 84 → 125 B-box zinc finger Domain
PF13445 zf-RING_UBOX 16 → 54 RING-type zinc-finger Domain
PF13765 PRY 296 → 344 SPRY-associated domain Family
Sequence 
MAWQVSLLELEDWLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAV
DGSSSLPNVSLARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHH
PVTPVSTVYSRMKEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHKF
IRKFHSMASRAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDP
ATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSD
WRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHY
EQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLS
PEQPTKL
Sequence length 487
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Antigen processing: Ubiquitination & Proteasome degradation

No strongly related genes found yet for TRIM50.

No additional diseases found yet through genes similar to TRIM50.