TRIM17 (tripartite motif containing 17)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 51127
• Gene name: Tripartite motif containing 17
• Gene symbol: TRIM17
• Synonyms (NCBI Gene): RBCC, RNF16, terf
• Chromosome: 1
• Chromosome location: 1q42.13
• Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The p

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029963	hsa-miR-26b-5p	Microarray	19088304
MIRT716224	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT716223	hsa-miR-6729-3p	HITS-CLIP	19536157
MIRT716222	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT716221	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT716220	hsa-miR-4786-5p	HITS-CLIP	19536157
MIRT716219	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT716218	hsa-miR-4471	HITS-CLIP	19536157
MIRT716217	hsa-miR-8059	HITS-CLIP	19536157
MIRT716216	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT716215	hsa-miR-183-3p	HITS-CLIP	19536157
MIRT716224	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT716223	hsa-miR-6729-3p	HITS-CLIP	19536157
MIRT716222	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT716221	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT716220	hsa-miR-4786-5p	HITS-CLIP	19536157
MIRT716219	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT716218	hsa-miR-4471	HITS-CLIP	19536157
MIRT716217	hsa-miR-8059	HITS-CLIP	19536157
MIRT716216	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT716215	hsa-miR-183-3p	HITS-CLIP	19536157
MIRT1453245	hsa-miR-2467-3p	CLIP-seq
MIRT1453246	hsa-miR-331-3p	CLIP-seq
MIRT1453247	hsa-miR-370	CLIP-seq
MIRT1453248	hsa-miR-4764-3p	CLIP-seq
MIRT2356935	hsa-miR-1207-5p	CLIP-seq
MIRT2356936	hsa-miR-3665	CLIP-seq
MIRT2356937	hsa-miR-4736	CLIP-seq
MIRT2356938	hsa-miR-4763-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19358823
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19358823, 22493164, 25127057, 25416956, 26871637, 29892012, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0006914	Process	Autophagy	IDA	25127057
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	25127057
GO:0032880	Process	Regulation of protein localization	IMP	25127057
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051865	Process	Protein autoubiquitination	IDA	19358823
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

Other IDs

• MIM: 606123
• HGNC: 13430
• e!Ensembl: ENSG00000162931

Protein

• UniProt ID: Q9Y577
• Protein name: E3 ubiquitin-protein ligase TRIM17 (EC 2.3.2.27) (RING finger protein 16) (RING-type E3 ubiquitin transferase TRIM17) (Testis RING finger protein) (Tripartite motif-containing protein 17)
• Protein function: E3 ubiquitin ligase that plays important roles in the regulation of neuronal apoptosis, selective autophagy or cell proliferation (PubMed:19358823, PubMed:22023800, PubMed:27562068). Stimulates the degradation of kinetochore ZW10 interacting pro
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00622	SPRY	350 → 470	SPRY domain	Family
  PF00643	zf-B_box	94 → 135	B-box zinc finger	Domain
  PF13445	zf-RING_UBOX	16 → 63	RING-type zinc-finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Almost exclusively in the testis. {ECO:0000269|PubMed:19358823}.
• Sequence:

  MEAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRACIQLSWEKARGKKGRRKRKGSF
  PCPECREMSPQRNLLPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVV
  CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
  RRERIVLEFEKMNLYLVEEEQRLLQALETEEEETASRLRESVACLDRQGHSLELLLLQLE
  ERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD
  ATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGMNIT
  GDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGI
  FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG

• Sequence length: 477

Pathways

Reactome Pathway:

Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Colon adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Glioma	Glioma	Pubtator	37367937	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18773414, 21231912		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30042493	Associate	★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	11030761		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30485814		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18773414, 21231912		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for TRIM17.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TRIM17.