TRGV3 (T cell receptor gamma variable 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 6976
Gene name T cell receptor gamma variable 3
Gene symbol TRGV3
Synonyms (NCBI Gene)
TCRGV3V1S3
Chromosome 7
Chromosome location 7p14.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 3458221
GO:0006955 Process Immune response NAS 3458221
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A TRGV3
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P03979
Protein name T cell receptor gamma variable 3 (T-cell receptor gamma V-gamma-1.1 region)
Protein function V region of the variable domain of T cell receptor (TR) gamma chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epitheli
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 25 → 118 Immunoglobulin V-set domain Domain
Sequence 
MRWALLVLLAFLSPASQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGK
APQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDR
Sequence length 118
Interactions View interactions

No strongly related genes found yet for TRGV3.

No additional diseases found yet through genes similar to TRGV3.