TRGV10 (T cell receptor gamma variable 10 (non-functional))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 6984
Gene name T cell receptor gamma variable 10 (non-functional)
Gene symbol TRGV10
Synonyms (NCBI Gene)
TCRGV10V3P
Chromosome 7
Chromosome location 7p14.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0009897 Component External side of plasma membrane IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A TRGV10
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A0A0MS01
Protein name Probable non-functional T cell receptor gamma variable 10
Protein function Probable non-functional open reading frame (ORF) of V region of the variable domain of T cell receptor (TR) gamma chain (PubMed:24600447). Non-functional ORF generally cannot participate in the synthesis of a productive T cell receptor (TR) chai
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 21 → 117 Immunoglobulin V-set domain Domain
Sequence 
MSLLEAFAFSSWALGLGLSKVEQFQLSISTEVKKSIDIPCKISSTRFETDVIHWYRQKPN
QALEHLIYIVSTKSAARRSMGKTSNKVEARKNSQTLTSILTIKSVEKEDMAVYYCAAWD
Sequence length 119
Interactions View interactions

No strongly related genes found yet for TRGV10.

No additional diseases found yet through genes similar to TRGV10.