Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6967
Gene name	T cell receptor gamma constant 2
Gene symbol	TRGC2
Synonyms (NCBI Gene)	TCRGC2TRGC2(2X)TRGC2(3X)
Chromosome	7
Chromosome location	7p14.1

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	30976362
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	NAS	3458221
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	3458221, 30976362
GO:0006955	Process	Immune response	NAS	3458221
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0042101	Component	T cell receptor complex	IEA
GO:0042106	Component	Gamma-delta T cell receptor complex	NAS	16418397
GO:0050852	Process	T cell receptor signaling pathway	NAS	30976362

MIM	HGNC	e!Ensembl
615450	12276	ENSG00000227191

P03986

Protein name

T cell receptor gamma constant 2

Protein function

Constant region of T cell receptor (TR) gamma chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries be

PDB

1HXM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07654	C1-set	13 → 95	Immunoglobulin C1-set domain	Domain

Sequence

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEG
NTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYN
YSKDANDVITMDPKDNWSKDANDTLLLQLTNTSAYYTYLLLLLKSVVYFAIITCCLLRRT
AFCCNGEKS

Sequence length

189

Interactions

View interactions

Related Genes Genes most often co-reported with TRGC2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TRGC2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TRGC2 (see Related Genes above), that are NOT already directly curated for TRGC2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TRGC2.

TRGC2 (T cell receptor gamma constant 2)

Bookmark This Gene