TRGC1 (T cell receptor gamma constant 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 6966
Gene name T cell receptor gamma constant 1
Gene symbol TRGC1
Synonyms (NCBI Gene)
C1TCRGTCRGC1
Chromosome 7
Chromosome location 7p14.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 30976362
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 30976362
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
186970 12275 ENSG00000211689
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CF51
Protein name T cell receptor gamma constant 1
Protein function Constant region of T cell receptor (TR) gamma chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries be
PDB 4LFH , 4LHU , 8JBV , 8JC0 , 8JCB , 8WXE , 8WY0 , 8WYI , 8YC0 , 9CI8 , 9CIA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 13 → 95 Immunoglobulin C1-set domain Domain
Sequence 
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEG
NTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDN
CSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS
Sequence length 173
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A2JGV3
Protein name T-cell receptor gamma alternate reading frame protein (TARP)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected at low levels in the ductal cells of the salivary gland but not in the acinar cells (at protein level) (PubMed:28153567). Expressed in endometrium (at protein level) (PubMed:24238509). Expressed in epithelial cells within the
Sequence 
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEG
NTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDN
CSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS
Sequence length 173
Interactions View interactions

No strongly related genes found yet for TRGC1.

No additional diseases found yet through genes similar to TRGC1.