Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	11219
Gene name	Three prime repair exonuclease 2
Gene symbol	TREX2
Synonyms (NCBI Gene)	-
Chromosome	X
Chromosome location	Xq28
Summary	This gene encodes a nuclear protein with 3` to 5` exonuclease activity. The encoded protein participates in double-stranded DNA break repair, and may interact with DNA polymerase delta. [provided by RefSeq, Nov 2012]

miRTarBase ID	miRNA	Experiments	Reference
MIRT022944	hsa-miR-124-3p	Microarray	18668037

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IDA	11279105
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	EXP	15661738
GO:0003677	Function	DNA binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004527	Function	Exonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006259	Process	DNA metabolic process	IDA	11279105
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	10391904
GO:0006308	Process	DNA catabolic process	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0008296	Function	3'-5'-DNA exonuclease activity	IBA
GO:0008296	Function	3'-5'-DNA exonuclease activity	IDA	11279105
GO:0008296	Function	3'-5'-DNA exonuclease activity	IEA
GO:0008311	Function	Double-stranded DNA 3'-5' DNA exonuclease activity	IEA
GO:0008408	Function	3'-5' exonuclease activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	11279105
GO:0046872	Function	Metal ion binding	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	15661738

MIM	HGNC	e!Ensembl
300370	12270	ENSG00000183479

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9BQ50
Protein name	Three prime repair exonuclease 2 (EC 3.1.11.2) (3'-5' exonuclease TREX2)
Protein function	Exonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.
PDB	1Y97
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus. {ECO:0000269\|PubMed:11278605}.
Sequence	MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKL TLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGF DYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYF RAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA
Sequence length	236
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Carcinogenesis	Carcinogenesis	Pubtator	37586363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31053176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31053176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35484177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	31222049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31053176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18092167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31053176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parakeratosis	Parakeratosis	BEFREE	27365293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15581481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27365293, 27884288, 30357414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26090614		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with TREX2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TREX2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TREX2 (see Related Genes above), that are NOT already directly curated for TREX2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TREX2.

TREX2 (three prime repair exonuclease 2)

Bookmark This Gene