TRDV2 (T cell receptor delta variable 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28517
Gene name T cell receptor delta variable 2
Gene symbol TRDV2
Synonyms (NCBI Gene)
hDV102S1
Chromosome 14
Chromosome location 14q11.2
Summary T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
GO:0042101 Component T cell receptor complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A TRDV2
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0JD36
Protein name T cell receptor delta variable 2
Protein function V region of the variable domain of T cell receptor (TR) delta chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epitheli
PDB 8JC0 , 8WY0 , 8WYI , 8YC0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 25 → 115 Immunoglobulin V-set domain Domain
Sequence 
MQRISSLIHLSLFWAGVMSAIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKT
QGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCACDT
Sequence length 115
Interactions View interactions

No strongly related genes found yet for TRDV2.

No additional diseases found yet through genes similar to TRDV2.